Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.17
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ductal carcinoma in situ 1.100 8.8e-03
group 3 medulloblastoma 1.300 8.9e-03
inflammatory breast cancer -1.200 6.2e-03
intraductal papillary-mucinous adenoma (... 1.200 5.2e-03
osteosarcoma -2.564 6.9e-10
ovarian cancer 1.100 1.4e-06
pancreatic ductal adenocarcinoma liver m... 1.091 1.4e-02
primary Sjogren syndrome -1.400 3.7e-02
psoriasis -1.500 3.4e-29

Synonym

Accession Q8N4Y2 D5LPR2 Q8NBW8
Symbols EFCAB4A

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

AA Sequence

MASPGKPGADEAQEEEGELEGGSAGPRAAILEQAEELFLLCDKEAKGFITKHDLQGLQSDLPLTPEQLEA      1 - 70
VFESLDRAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLDVQGTAGSLDEEEEEEERFHT     71 - 140
VLEQLGVAPVLGKQRAVRTLWARLQRERPELLGSFEDVLIRASACLEEAARERDGLEQALRRRESEHERE    141 - 210
VRALYEETEQLREQSRRPPSQNFARGERRSRLELELQSREQDLERAGLRQRELEQQLHAQAAEHLEAQAQ    211 - 280
NSQLWRAHEALRTQLEGAQEQIRRLESEARGRQEQTQRDVVAVSRNMQKEKVSLLRQLELLRELNTRLRD    281 - 350
DRDACEARRAGSSCRKALTTARLPGPTCCCCCCWARPPRRGSGHLPSAR                         351 - 399
//

Text Mined References (11)

PMID Year Title