Property Summary

Ligand Count 56
NCBI Gene PubMed Count 18
PubMed Score 3.72
PubTator Score 3.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.200 1.2e-02
Breast cancer -1.100 6.3e-03
fibroadenoma 1.300 5.0e-02
gastric carcinoma 1.300 3.3e-02
glioblastoma 1.200 1.6e-03
interstitial cystitis -1.100 1.2e-04
intraductal papillary-mucinous adenoma (... 1.500 1.1e-03
intraductal papillary-mucinous carcinoma... 1.900 4.8e-02
intraductal papillary-mucinous neoplasm ... 1.600 1.6e-02
lung carcinoma 1.200 5.3e-13
medulloblastoma 1.400 1.8e-03
medulloblastoma, large-cell 2.400 2.7e-04
osteosarcoma -1.064 4.4e-02
pediatric high grade glioma 1.100 1.7e-04

 GO Function (1)

Gene RIF (6)

AA Sequence

MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFI      1 - 70
ARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKV     71 - 140
YLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDFLTRIISQLQE    141 - 210
AHEEKNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQL    211 - 280
TQKQKRLEGQCTALHHDKHETKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEME    281 - 350
VYRVTESLQREKAGLLKQLDFLRCVGGHWPVLRAPPRSLGSEGPV                             351 - 395
//

Text Mined References (19)

PMID Year Title