Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.72
PubTator Score 3.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (4)

PMID Text
25475730 endothelial cells contain a long variant of CRACR2A which is an EF-hand-containing Rab protein that lacks impact on CRAC channels
20708005 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20418871 CRACR2A interacts directly with Orai1 and STIM1, forming a ternary complex that dissociates at elevated Ca(2+) concentrations; is a key regulator of CRAC channel-mediated SOCE
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFI      1 - 70
ARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKV     71 - 140
YLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDFLTRIISQLQE    141 - 210
AHEEKNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQL    211 - 280
TQKQKRLEGQCTALHHDKHETKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEME    281 - 350
VYRVTESLQREKAGLLKQLDFLRCVGGHWPVLRAPPRSLGSEGPV                             351 - 395
//

Text Mined References (17)

PMID Year Title
25475730 2015 Expression of a long variant of CRACR2A that belongs to the Rab GTPase protein family in endothelial cells.
25416956 2014 A proteome-scale map of the human interactome network.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21993531 2012 Genome-wide association study does not reveal major genetic determinants for anti-cytomegalovirus antibody response.
20708005 2010 Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease.
20418871 2010 A novel EF-hand protein, CRACR2A, is a cytosolic Ca2+ sensor that stabilizes CRAC channels in T cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19478329 Genome-wide study of single-nucleotide polymorphisms associated with azoospermia and severe oligozoospermia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.