Property Summary

NCBI Gene PubMed Count 64
PubMed Score 167.01
PubTator Score 137.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.100 1.3e-05
esophageal adenocarcinoma -3.100 2.0e-02
psoriasis 2.200 3.0e-143
osteosarcoma 1.989 2.3e-02
non-small cell lung cancer 2.365 4.4e-15
lung cancer 2.600 1.9e-06
breast carcinoma 1.100 2.9e-02
interstitial cystitis -1.500 2.7e-03
lung adenocarcinoma 4.000 2.0e-11
group 3 medulloblastoma 1.600 2.3e-02
Endometriosis 1.060 3.7e-02
ductal carcinoma in situ 2.200 2.1e-04
invasive ductal carcinoma 2.800 3.6e-04
ovarian cancer 2.600 1.6e-06
pituitary cancer 1.700 5.9e-04
facioscapulohumeral dystrophy 1.700 4.7e-02

Gene RIF (36)

PMID Text
26839961 in esophageal squamous carcinogenesis by significantly inhibiting cell growth, inducing cell apoptosis and blocking cell metastasis both in vitro and in vivo
25320093 The anticarcinogenic activities of CRABP2 are mediated by both HuR and RAR.
25034531 we demonstrated significant changes in CRABP1 and CRABP2 expression in non-small cell lung cancer samples
24751108 CBX3 and CRABP2 expression was markedly increased in lung cancer tissues
24709110 overexpression of CRABP-II is a late event of pancreatic carcinogenesis, and it could be used as a diagnostic marker
24687854 CRABP2 controls mRNA stabilization by HuR.
24269351 Factors involved in the retinoid pathway, in particular upregulation of CRBP, CRABP1 and CRABP2, also showed differential expression in tumors with different histological subtypes
24059243 Reengineering of cellular retinoic acid binding protein II (CRABPII) to be capable of binding retinal as a protonated Schiff base is described
23833249 all three proteins (RDH10, RALDH2, and CRABP2) appeared to be required for ATRA production induced by activation of PPARgamma
23327868 E-FABP showed high exp ression in NSCLC, and the increased E-FABP expression may involved in the occurrence and development of NSCLC
22275178 Hypermethylation in the CpG island of the CRABP2 gene is associated with astrocytic gliomas.
22153617 Aberrant methylation in CRABP-II reduces the expression of CRABP-II that in turn confers retinoic acid resistance in medulloblastoma cells.
22010213 Low CRABP2 is associated with pancreatic ductal adenocarcinoma.
21998312 Nuclear translocation of cellular retinoic acid-binding protein II is regulated by retinoic acid-controlled SUMOylation
21605859 Trophoblast spheroids cocultured with endometrial cells overexpressing CRABP2 are defective in expansion and exhibit apoptosis, suggesting that CRABP2 is involved in abnormal endometrium-trophoblast interaction, leading to implantation failure.
21414315 Data show that NIPER-4 induces cIAP1-mediated ubiquitylation of CRABP-II, resulting in the proteasomal degradation.
20413122 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20308937 Individual variation in ALDH1A2/CRABP2 genes may account for subtle variations in retinoic acid-dependent human embryogenesis.
20308937 Observational study of gene-disease association. (HuGE Navigator)
20019841 Data sghow a higher frequency of CRABP2 and MX1 hypermethylation in primary HNSCC when compared with lymphocytes from healthy individuals.
19173001 Derangement/lack of a critical factor necessary for RARalpha function induces epigenetic repression of a RA-regulated gene network downstream of RARalpha, with major pleiotropic biological outcomes.
18955045 MycN and DNA methylation are responsible for CRABP-II expression in pediatric tumors and demethylation of CRABP-II may be an early event in tumor development.
18343808 Retinoic acid and retinol regulate expression of cellular retinol binding protein 1 and cellular RA binding protein 2 in fibroid and myometrial cells.
17484622 Observational study of gene-disease association. (HuGE Navigator)
17484622 results show that the CRABP2 gene is associated with increased plasma LDL-C concentrations. Carriers of the C allele had significantly higher LDL-C in healthy males, HIV-infected patients, and patients with familial hypercholesterolemia
17187826 AP2 factors regulate CRABPII expression in human mammary epithelial cells and breast cancer cells
16979656 Results describe the structure of apo-wild type (WT) CRABPII at 1.35 A and show that apo- and holo-CRABPII share very similar structures.
16912187 MycN binds to the promoter of CRABP-II and induces CRABP-II transcription directly in neuroblastoma.
16215318 CRABP-II overexpression in CAKI-2 RCC cells did not significantly influence RA associated antiproliferative actions.
15870697 Transient transfection of either all-trans-retinoic acid (ATRA) receptor alpha or estrogen receptor alpha expression vectors increased CRABPII expression in MDA-MB-231 cells
15866176 Data suggest that the ligand-controlled nuclear localization signal of CRABP-II may represent a general mechanism for posttranslational regulation of the subcellular distribution of a protein.
15225641 Phosphorylation/dephosphorylation of retinoic x receptor alpha via protein kinase C may be involved in the regulation of CRABP-II gene expression.
14766225 CRABP-II has a role in wound re-epithelialisation by dermal fibroblasts
12844477 In this study, we excluded mutations within the complete coding region and the promoter of LMNA and the CRABP II gene in HIV-1 infected patients with lipodystrophy
12482873 Cyclin D3 is a cofactor of retinoic acid receptors, modulating their activity in the presence of this protein
11909957 Direct channeling of retinoic acid between cellular retinoic acid-binding protein II and retinoic acid receptor sensitizes mammary carcinoma cells to retinoic acid-induced growth arrest.

AA Sequence

MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGE      1 - 70
EFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE       71 - 138
//

Text Mined References (68)

PMID Year Title
26839961 2016 Cellular Retinoic Acid Binding Protein 2 Is Strikingly Downregulated in Human Esophageal Squamous Cell Carcinoma and Functions as a Tumor Suppressor.
25416956 2014 A proteome-scale map of the human interactome network.
25320093 2014 Cellular retinoic acid-binding protein 2 inhibits tumor growth by two distinct mechanisms.
25034531 2014 Expression and clinical significance of CRABP1 and CRABP2 in non-small cell lung cancer.
24751108 2014 RNA sequencing identifies novel markers of non-small cell lung cancer.
24709110 2014 CRABP-II is a highly sensitive and specific diagnostic molecular marker for pancreatic ductal adenocarcinoma in distinguishing from benign pancreatic conditions.
24687854 2014 Transcript stabilization by the RNA-binding protein HuR is regulated by cellular retinoic acid-binding protein 2.
24269351 2014 Proteome analysis of the effects of all-trans retinoic acid on human germ cell tumor cell lines.
24059243 2013 Rational design of a colorimetric pH sensor from a soluble retinoic acid chaperone.
23833249 2013 RDH10, RALDH2, and CRABP2 are required components of PPAR?-directed ATRA synthesis and signaling in human dendritic cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23327868 2013 [Expressions and significances of CRABPII and E-FABP in non-small cell lung cancer].
22275178 2012 Epigenetically mediated downregulation of the differentiation-promoting chaperon protein CRABP2 in astrocytic gliomas.
22153617 2012 CRABP-II methylation: a critical determinant of retinoic acid resistance of medulloblastoma cells.
22010213 2012 Molecular determinants of retinoic acid sensitivity in pancreatic cancer.
21998312 2011 Nuclear translocation of cellular retinoic acid-binding protein II is regulated by retinoic acid-controlled SUMOylation.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21605859 2011 Impaired expansion of trophoblast spheroids cocultured with endometrial cells overexpressing cellular retinoic acid-binding protein 2.
21414315 2011 Specific degradation of CRABP-II via cIAP1-mediated ubiquitylation induced by hybrid molecules that crosslink cIAP1 and the target protein.
21269460 2011 Initial characterization of the human central proteome.
20622962 2010 Time-course transcriptional profiling of human amniotic fluid-derived stem cells using microarray.
20413122 2010 Soluble fibre (Plantago ovata husk) reduces plasma low-density lipoprotein (LDL) cholesterol, triglycerides, insulin, oxidised LDL and systolic blood pressure in hypercholesterolaemic patients: A randomised trial.
20308937 2010 Newborn serum retinoic acid level is associated with variants of genes in the retinol metabolism pathway.
20019841 2009 Epigenetic silencing of CRABP2 and MX1 in head and neck tumors.
19648781 2009 Antiaging action of retinol: from molecular to clinical.
19173612 2009 Temporal analysis of neural differentiation using quantitative proteomics.
19173001 2009 Derangement of a factor upstream of RARalpha triggers the repression of a pleiotropic epigenetic network.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18955045 2008 Regulation of CRABP-II expression by MycN in Wilms tumor.
18343808 2008 Retinoids regulate genes involved in retinoic acid synthesis and transport in human myometrial and fibroid smooth muscle cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17893666 2007 Molecular and metabolic retinoid pathways in the human ocular surface.
17553814 2007 Retinoic acid pathway genes show significantly altered expression in uterine fibroids when compared with normal myometrium.
17484622 2007 Association of a polymorphism in the promoter of the cellular retinoic acid-binding protein II gene (CRABP2) with increased circulating low-density lipoprotein cholesterol.
17447762 2007 Protein design: reengineering cellular retinoic acid binding protein II into a rhodopsin protein mimic.
17187826 2007 AP2 transcription factors regulate expression of CRABPII in hormone responsive breast carcinoma.
16979656 2006 The structure of Apo-wild-type cellular retinoic acid binding protein II at 1.4 A and its relationship to ligand binding and nuclear translocation.
16912187 2006 Cellular retinoic acid-binding protein II is a direct transcriptional target of MycN in neuroblastoma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16237707 2005 Analysis of ALDH1A2, CYP26A1, CYP26B1, CRABP1, and CRABP2 in human neural tube defects suggests a possible association with alleles in ALDH1A2.
16215318 2005 Expression and functional influence of cellular retinoic acid-binding protein II in renal cell carcinoma.
16211222 2005 Cellular retinoic acid-binding protein 2 is down-regulated in prostate cancer.
15870697 2005 Expression of estrogen receptor alpha, retinoic acid receptor alpha and cellular retinoic acid binding protein II genes is coordinately regulated in human breast cancer cells.
15866176 2005 A ligand-activated nuclear localization signal in cellular retinoic acid binding protein-II.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15225641 2004 Vitamin E activates CRABP-II gene expression in cultured human fibroblasts, role of protein kinase C.
14766225 2004 Differential expression of CRABP-II in fibroblasts derived from dermis and subcutaneous fat.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12844477 2003 Lack of mutations in LMNA, its promoter region, and the cellular retinoic acid binding protein II (CRABP II) in HIV associated lipodystrophy.
12482873 2003 Cyclin D3 is a cofactor of retinoic acid receptors, modulating their activity in the presence of cellular retinoic acid-binding protein II.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11909957 2002 Direct channeling of retinoic acid between cellular retinoic acid-binding protein II and retinoic acid receptor sensitizes mammary carcinoma cells to retinoic acid-induced growth arrest.
10531482 1999 Structures of cellular retinoic acid binding proteins I and II in complex with synthetic retinoids.
9737883 1998 NMR study suggests a major role for Arg111 in maintaining the structure and dynamical properties of type II human cellular retinoic acid binding protein.
9737849 1998 NMR solution structure of type II human cellular retinoic acid binding protein: implications for ligand binding.
9600845 1998 Crystal structure of apo-cellular retinoic acid-binding protein type II (R111M) suggests a mechanism of ligand entry.
9238678 1996 Retinoic acid suppresses in-vitro decidualization of human endometrial stromal cells.
9154115 1997 Assignment of the genes for cellular retinoic acid binding protein 1 (CRABP1) and 2 (CRABP2) to human chromosome band 15q24 and 1q21.3, respectively, by in situ hybridization.
8381448 1993 Retinoids and state of differentiation modulate CRABP II gene expression in a skin equivalent.
8048948 1994 Expression of retinoic acid receptor subtypes and cellular retinoic acid binding protein-II mRNAs during differentiation of human trophoblast cells.
7704533 1994 Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid.
7563063 1995 Crystal structure of cellular retinoic acid binding protein I shows increased access to the binding cavity due to formation of an intermolecular beta-sheet.
1654334 1991 Molecular cloning of two human cellular retinoic acid-binding proteins (CRABP). Retinoic acid-induced expression of CRABP-II but not CRABP-I in adult human skin in vivo and in skin fibroblasts in vitro.
1334086 1992 Structure of the human cellular retinoic acid-binding protein II gene. Early transcriptional regulation by retinoic acid.
1321791 1992 Assignment of the human CRABP-II gene to chromosome 1q21 by nonisotopic in situ hybridization.
1309505 1992 The molecular cloning and expression of two CRABP cDNAs from human skin.