Property Summary

NCBI Gene PubMed Count 34
PubMed Score 306.17
PubTator Score 167.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Astrocytoma, Pilocytic -2.600 4.7e-07
ependymoma -1.300 2.2e-02
fibroadenoma 1.900 3.2e-02
glioblastoma -1.900 4.7e-04
group 3 medulloblastoma -2.100 8.1e-03
invasive ductal carcinoma -2.457 2.2e-04
non-inflammatory breast cancer -2.700 2.9e-03
oligodendroglioma -1.200 1.8e-02
pediatric high grade glioma -1.600 2.1e-02
pituitary cancer 1.700 5.8e-03
psoriasis -1.300 2.4e-06

Gene RIF (23)

AA Sequence

MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGE      1 - 70
GFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE        71 - 137
//

Text Mined References (35)

PMID Year Title