Property Summary

NCBI Gene PubMed Count 32
PubMed Score 302.50
PubTator Score 167.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma -2.300 1.7e-06
oligodendroglioma -1.200 1.8e-02
psoriasis -3.100 6.9e-04
glioblastoma -1.900 4.7e-04
group 3 medulloblastoma -2.100 8.1e-03
fibroadenoma 1.900 3.2e-02
pediatric high grade glioma -1.600 2.1e-02
pilocytic astrocytoma -2.700 3.2e-07
invasive ductal carcinoma -2.457 2.2e-04
non-inflammatory breast cancer -2.700 2.9e-03
pituitary cancer 1.700 5.8e-03

Synonym

Accession P29762 Q6IAY7 Q8WTV5
Symbols RBP5
CRABP
CRABPI
CRABP-I

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (21)

PMID Text
26142905 CRABP1 expression is maintained in ER- and triple-negative breast tumors, and that elevated levels of CRABP1 is a significant indicator of high tumor grade, Ki67 immunoreactivity, and poor prognosis.
26124181 miR-93/miR-106b/miR-375-CIC-CRABP1 is a novel key regulatory axis in prostate cancer progression
25034531 we demonstrated significant changes in CRABP1 and CRABP2 expression in non-small cell lung cancer samples
24626200 the first evidence of pro-tumorigenic and pro-metastatic activity of CRABP1 in mesenchymal and neuroendocrine tumors.
24269351 Factors involved in the retinoid pathway, in particular upregulation of CRBP, CRABP1 and CRABP2, also showed differential expression in tumors with different histological subtypes
21270509 Results describe the mRNA expression of CRABP1, RERG, and GRP in pituitary adenomas.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20571834 Observational study of gene-disease association. (HuGE Navigator)
20571827 reduced expression of CRABP1 has a potential as a prognostic marker for serous adenocarcinoma which is the most frequent histological ovarian tumor type and also for clear cell carcinoma that often exhibits chemo-resistance.
19087254 The authors identified several dysregulated genes and proteins, but only the cellular retinoic acid binding protein 1 (CRABP1) was up-regulated exclusively in cells expressing an increased Abeta42/Abeta40 ratio.
18000064 supports an active role for PLZF and RARalpha-PLZF in leukemogenesis, identifies up-regulation of CRABPI
17727842 As epidermal basal keratinocyte proliferation is stimulated by paracrine growth factors secreted by ATRA activated suprabasal keratinocytes, our results indicate that CRABPI overexpression in suprabasal keratinocytes enhances ATRA.
17623056 DNA hypermethylation of tumour suppressor genes seems to play an important role in ovarian carcinogenesis and HOXA9, HOXB5, SCGB3A1, and CRABP1 are identified as novel hypermethylated target genes in this tumour type
17438526 Frequent methylation-associated silencing of CRABP1 is associated with esophageal squamous-cell carcinoma
17167179 Hypermethylation was subsequently identified for three of four analyzed genes, ADAMTS1 (85%), CRABP1 (90%), and NR3C1 (35%).
16254461 Real-time RT-PCR analysis disclosed a significant lack of CRABP-I expression in four renal cell carcinoma cell lines
15515157 Decreases in the CRABP1 (cellular retinoic acid binding protein 1) and TFF3 (trefoil factor 3) expression levels identified these as candidate molecular biomarkers for papillary thyroid carcinoma.
15281009 increased CYP26-mediated catabolism of retinoic by CRABP-I transfection might decrease the amount of retinoic acid that is accessible to the nuclear receptors
14713576 CRABP I plays an important role not only in mediating the retinoid effects, but also in modulating the radiation sensitivity of tumour cells after combined retinoic acid radiation treatment.
14605320 CSF of Moyamoya Disease [MMD] patients reveals high CRABP-I expression suggesting that the elevation of CRABP-I in CSF may be a candidate for pathogenesis of MMD
12640681 Loss of cellular retinoic acid binding protein 1 function due to hypermethylation of its promoter leads to pathogenesis of papillary thyroid carcinoma

AA Sequence

MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGE      1 - 70
GFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE        71 - 137
//

Text Mined References (33)

PMID Year Title
26142905 2015 CRABP1 is associated with a poor prognosis in breast cancer: adding to the complexity of breast cancer cell response to retinoic acid.
26124181 2015 miR-93/miR-106b/miR-375-CIC-CRABP1: a novel regulatory axis in prostate cancer progression.
25034531 2014 Expression and clinical significance of CRABP1 and CRABP2 in non-small cell lung cancer.
24626200 2014 CRABP1 provides high malignancy of transformed mesenchymal cells and contributes to the pathogenesis of mesenchymal and neuroendocrine tumors.
24269351 2014 Proteome analysis of the effects of all-trans retinoic acid on human germ cell tumor cell lines.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21270509 2011 Expression of CRABP1, GRP, and RERG mRNA in clinically non-functioning and functioning pituitary adenomas.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20571834 2010 Polymorphisms in TGFB1 and PDGFRB are associated with Moyamoya disease in European patients.
20571827 2011 CRABP1-reduced expression is associated with poorer prognosis in serous and clear cell ovarian adenocarcinoma.
19087254 2008 Upregulation of CRABP1 in human neuroblastoma cells overproducing the Alzheimer-typical Abeta42 reduces their differentiation potential.
18000064 2007 RARalpha-PLZF overcomes PLZF-mediated repression of CRABPI, contributing to retinoid resistance in t(11;17) acute promyelocytic leukemia.
17727842 2008 Overexpression of CRABPI in suprabasal keratinocytes enhances the proliferation of epidermal basal keratinocytes in mouse skin topically treated with all-trans retinoic acid.
17623056 2007 DNA methylation profiling of ovarian carcinomas and their in vitro models identifies HOXA9, HOXB5, SCGB3A1, and CRABP1 as novel targets.
17438526 2007 Frequent methylation-associated silencing of a candidate tumor-suppressor, CRABP1, in esophageal squamous-cell carcinoma.
17167179 2006 ADAMTS1, CRABP1, and NR3C1 identified as epigenetically deregulated genes in colorectal tumorigenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16254461 Cellular retinoic acid binding protein I: expression and functional influence in renal cell carcinoma.
15607035 2004 Systematic identification of hepatocellular proteins interacting with NS5A of the hepatitis C virus.
15515157 2004 TIMP1 and SERPIN-A overexpression and TFF3 and CRABP1 underexpression as biomarkers for papillary thyroid carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15281009 2004 The effect of cellular retinoic acid binding protein-I expression on the CYP26-mediated catabolism of all-trans retinoic acid and cell proliferation in head and neck squamous cell carcinoma.
14713576 2003 CRABP I expression and the mediation of the sensitivity of human tumour cells to retinoic acid and irradiation.
14605320 2003 Elevation of CRABP-I in the cerebrospinal fluid of patients with Moyamoya disease.
12640681 2003 Hypermethylation, but not LOH, is associated with the low expression of MT1G and CRABP1 in papillary thyroid carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11909957 2002 Direct channeling of retinoic acid between cellular retinoic acid-binding protein II and retinoic acid receptor sensitizes mammary carcinoma cells to retinoic acid-induced growth arrest.
9704013 1998 Regulation of cellular retinoic acid binding protein (CRABP II) during human monocyte differentiation in vitro.
9154115 1997 Assignment of the genes for cellular retinoic acid binding protein 1 (CRABP1) and 2 (CRABP2) to human chromosome band 15q24 and 1q21.3, respectively, by in situ hybridization.
9005841 1996 Biosynthesis and function of all-trans- and 9-cis-retinoic acid in parathyroid cells.
2825608 1987 Cellular retinoid-binding proteins.
1654334 1991 Molecular cloning of two human cellular retinoic acid-binding proteins (CRABP). Retinoic acid-induced expression of CRABP-II but not CRABP-I in adult human skin in vivo and in skin fibroblasts in vitro.
1309505 1992 The molecular cloning and expression of two CRABP cDNAs from human skin.