Property Summary

NCBI Gene PubMed Count 25
PubMed Score 73.31
PubTator Score 12.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 1.800 5.4e-05
glioblastoma 2.800 1.4e-03
chronic lymphosyte leukemia -1.800 2.8e-09
posterior fossa group B ependymoma 2.400 1.1e-10
Duchenne muscular dystrophy 1.080 3.4e-06
tuberculosis 1.800 9.0e-08
intraductal papillary-mucinous adenoma (... -2.500 8.6e-04
intraductal papillary-mucinous carcinoma... -2.800 2.5e-04
colon cancer -1.300 1.8e-02
lung cancer -2.000 5.8e-05
diabetes mellitus -1.200 3.1e-02
interstitial cystitis 1.200 6.5e-03
adult high grade glioma 1.600 3.3e-03
group 3 medulloblastoma -1.100 1.8e-02
pilocytic astrocytoma 1.500 1.7e-07
primary Sjogren syndrome 1.500 8.4e-04
lung adenocarcinoma -1.400 1.6e-04
lung carcinoma -1.400 4.1e-12
gastric carcinoma 2.100 2.1e-02
acute myeloid leukemia -1.600 1.3e-02
ulcerative colitis 1.500 2.6e-05
ovarian cancer -2.600 3.4e-06
pituitary cancer -1.400 2.4e-05
head and neck cancer -1.300 2.3e-03
facioscapulohumeral dystrophy 1.900 1.6e-02

Gene RIF (4)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of vitellogenic-like carboxypeptidase (CPVL) in peptide-treated PBMCs
21911749 genetic association studies in a Chinese population with type 2 diabetes: An SNP in CPVL (rs39059) is associated with diabetic retinopathy in a Chinese population of type 2 diabetic patients.
20460425 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLN      1 - 70
MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDF     71 - 140
PWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYV    141 - 210
PAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK    211 - 280
QNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN    281 - 350
DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK    351 - 420
IFKSDSEVAGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG                  421 - 476
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24132900 2013 Genome-wide association study of atypical psychosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21911749 2011 CPVL/CHN2 genetic variant is associated with diabetic retinopathy in Chinese type 2 diabetic patients.
21269460 2011 Initial characterization of the human central proteome.
20460425 2010 Replication study for the association between four Loci identified by a genome-wide association study on European American subjects with type 1 diabetes and susceptibility to diabetic nephropathy in Japanese subjects with type 2 diabetes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17903298 2007 Genome-wide association with diabetes-related traits in the Framingham Heart Study.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401439 2001 Cloning and characterization of CPVL, a novel serine carboxypeptidase, from human macrophages.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10610771 1999 Dominance of intrinsic genetic factors in shaping the human immunoglobulin Vlambda repertoire.
10527689 1999 Immunoglobulin VH gene expression in human aging.
9780222 1998 Selective accumulation of related CD4+ T cell clones in the synovial fluid of patients with rheumatoid arthritis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.