Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.67
PubTator Score 3.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.484 3.4e-03
adult high grade glioma -2.800 1.7e-04
astrocytic glioma -3.200 1.9e-03
atypical teratoid / rhabdoid tumor -1.600 3.8e-02
cystic fibrosis 2.446 8.9e-07
ependymoma -3.300 3.9e-03
glioblastoma -1.300 2.0e-02
group 3 medulloblastoma -3.000 1.0e-03
intraductal papillary-mucinous adenoma (... 1.300 3.9e-03
intraductal papillary-mucinous neoplasm ... 1.800 4.8e-02
invasive ductal carcinoma -1.200 6.0e-03
medulloblastoma, large-cell -4.400 4.3e-08
oligodendroglioma -3.000 6.5e-03
osteosarcoma 1.696 2.5e-04
ovarian cancer -2.200 2.6e-06
Pick disease 1.100 7.6e-05
primitive neuroectodermal tumor -3.200 7.3e-05
psoriasis -1.100 1.1e-06
tuberculosis 2.400 1.3e-08
urothelial carcinoma -2.300 1.1e-04

AA Sequence

MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLLDRDTFSKSDPICVLYVQGVGNKEWREFGRTEVID      1 - 70
NTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPG     71 - 140
KKCGTIILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVW    141 - 210
QAFKISVRALCNGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYT    211 - 280
NSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEI    281 - 350
VQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVIN    351 - 420
HVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVS    421 - 490
SRGKYAERDIVQFVPFRDYIDRSGNHILSMARLAKDVLAEIPEQFLSYMRARGIKPSPAPPPYTPPTHVL    491 - 560
QTQI                                                                      561 - 564
//

Text Mined References (18)

PMID Year Title