Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.21
PubTator Score 3.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma -2.300 1.1e-04
astrocytic glioma -3.200 1.9e-03
ependymoma -3.300 3.9e-03
oligodendroglioma -3.000 6.5e-03
osteosarcoma 1.696 2.5e-04
glioblastoma -1.700 1.1e-02
group 4 medulloblastoma -3.200 1.4e-05
cystic fibrosis 2.446 8.9e-07
atypical teratoid / rhabdoid tumor -1.600 3.8e-02
medulloblastoma, large-cell -4.400 4.3e-08
primitive neuroectodermal tumor -3.200 7.3e-05
tuberculosis 2.400 1.3e-08
intraductal papillary-mucinous adenoma (... 1.300 3.9e-03
intraductal papillary-mucinous neoplasm ... 1.800 4.8e-02
active Crohn's disease 1.484 3.4e-03
adult high grade glioma -2.800 1.7e-04
psoriasis -1.100 1.1e-06
Pick disease 1.100 7.6e-05
invasive ductal carcinoma -1.200 6.0e-03
ovarian cancer -2.200 2.6e-06

Synonym

Accession Q86YQ8 Q2TB41 Q86VY2
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLLDRDTFSKSDPICVLYVQGVGNKEWREFGRTEVID      1 - 70
NTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPG     71 - 140
KKCGTIILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVW    141 - 210
QAFKISVRALCNGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYT    211 - 280
NSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEI    281 - 350
VQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVIN    351 - 420
HVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVS    421 - 490
SRGKYAERDIVQFVPFRDYIDRSGNHILSMARLAKDVLAEIPEQFLSYMRARGIKPSPAPPPYTPPTHVL    491 - 560
QTQI                                                                      561 - 564
//

Text Mined References (18)

PMID Year Title
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12886257 2003 Fusion of AML1/Runx1 to copine VIII, a novel member of the copine family, in an aggressive acute myelogenous leukemia with t(12;21) translocation.
12670487 2003 Cloning, molecular characterization, and expression analysis of Copine 8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11123945 2000 Biochemical characterization of copine: a ubiquitous Ca2+-dependent, phospholipid-binding protein.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9430674 1998 The copines, a novel class of C2 domain-containing, calcium-dependent, phospholipid-binding proteins conserved from Paramecium to humans.