Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.76
PubTator Score 3.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
nephrosclerosis -1.099 2.9e-03
astrocytoma -2.200 3.1e-26
psoriasis -2.400 2.2e-45
glioblastoma -3.300 2.3e-06
oligodendroglioma -2.400 2.7e-26
osteosarcoma 1.468 2.8e-05
ependymoma -1.200 4.5e-02
sonic hedgehog group medulloblastoma -3.600 2.2e-08
atypical teratoid / rhabdoid tumor -3.700 2.1e-13
medulloblastoma, large-cell -2.900 6.1e-04
primitive neuroectodermal tumor -3.300 1.1e-05
pediatric high grade glioma -3.300 1.3e-08
pilocytic astrocytoma -3.500 3.9e-11
ovarian cancer -1.200 1.1e-05

Gene RIF (2)

PMID Text
26723968 expression of CPNE6 increased remarkably in brains of epileptic patients and in experimental epileptic rats. Expression is mainly in neurons.
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSDPEMGWVPEPPTMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVERTEVLRSCSSPV      1 - 70
FSRVLALEYFFEEKQPLQFHVFDAEDGATSPRNDTFLGSTECTLGQIVSQTKVTKPLLLKNGKTAGKSTI     71 - 140
TIVAEEVSGTNDYVQLTFRAYKLDNKDLFSKSDPFMEIYKTNEDQSDQLVWRTEVVKNNLNPSWEPFRLS    141 - 210
LHSLCSCDVHRPLKFLVYDYDSSGKHDFIGEFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSG    211 - 280
TVVLAQCTVEKVHTFLDYIMGGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQD    281 - 350
YDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVA    351 - 420
EPAQREQSTGQATKYSVLLVLTDGVVSDMAETRTAIVRASRLPMSIIIVGVGNADFSDMRLLDGDDGPLR    421 - 490
CPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAEVPRQVVEYYASQGISPGAPRPCTLATTPSPSP       491 - 557
//

Text Mined References (18)

PMID Year Title
26723968 2016 Increased expression of copine VI in patients with refractory epilepsy and a rat model.
25416956 2014 A proteome-scale map of the human interactome network.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12949241 2003 Tissue expression of copines and isolation of copines I and III from the cytosol of human neutrophils.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12440769 2002 Copines: a ubiquitous family of Ca(2+)-dependent phospholipid-binding proteins.
12044471 2002 NECABs: a family of neuronal Ca(2+)-binding proteins with an unusual domain structure and a restricted expression pattern.
11041869 2000 Characterization of human copine III as a phosphoprotein with associated kinase activity.
10403379 1999 Ca2(+)-dependent interaction of N-copine, a member of the two C2 domain protein family, with OS-9, the product of a gene frequently amplified in osteosarcoma.
9886090 1999 Localization and subcellular distribution of N-copine in mouse brain.
9645480 1998 N-copine: a novel two C2-domain-containing protein with neuronal activity-regulated expression.
9430674 1998 The copines, a novel class of C2 domain-containing, calcium-dependent, phospholipid-binding proteins conserved from Paramecium to humans.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.