Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.28
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -3.100 1.2e-03
posterior fossa group A ependymoma -3.700 1.9e-10
oligodendroglioma -2.500 7.0e-03
glioblastoma -3.200 6.0e-04
atypical teratoid / rhabdoid tumor -2.100 9.8e-03
medulloblastoma, large-cell -2.500 4.7e-02
primitive neuroectodermal tumor -3.200 4.1e-03
pediatric high grade glioma -2.200 3.8e-03
sonic hedgehog group medulloblastoma -3.500 3.6e-04
pilocytic astrocytoma -2.000 6.0e-03
lung carcinoma 3.000 9.4e-38
Pick disease -1.400 4.2e-02
psoriasis -1.600 7.0e-23

Synonym

Accession Q96A23 D3DNC5 Q8TEX1
Symbols CPN4
COPN4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
25328121 Single nucleotide polymorphisms in CPEN4 gene is associated with Coronary Artery Disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12670487 Cloning, molecular characterization, and expression analysis. May have an important role to play in prostate regulation and development.

AA Sequence

MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTC      1 - 70
INPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGK     71 - 140
SSITVIAEELSGNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSF    141 - 210
KVSVNSLCSGDPDRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQVQWECINPKYKAKKKNYKNS    211 - 280
GTVILNLCKIHKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQ    281 - 350
DYDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQSCLPKLQLYGPTNIAPIIQKV    351 - 420
AKSASEETNTKEASQYFILLILTDGVITDMADTREAIVHASHLPMSVIIVGVGNADFSDMQMLDGDDGIL    421 - 490
RSPKGEPVLRDIVQFVPFRNFKHASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP       491 - 557
//

Text Mined References (13)

PMID Year Title
25328121 2015 Associations between Genetic Variants and Angiographic Characteristics in Patients with Coronary Artery Disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23202439 2013 Genome-wide scan for copy number variation association with age at onset of Alzheimer's disease.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12949241 2003 Tissue expression of copines and isolation of copines I and III from the cytosol of human neutrophils.
12670487 2003 Cloning, molecular characterization, and expression analysis of Copine 8.
12522145 2003 Identification of targets for calcium signaling through the copine family of proteins. Characterization of a coiled-coil copine-binding motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9430674 1998 The copines, a novel class of C2 domain-containing, calcium-dependent, phospholipid-binding proteins conserved from Paramecium to humans.