Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.90
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -3.100 1.2e-03
Astrocytoma, Pilocytic -1.900 2.1e-02
atypical teratoid / rhabdoid tumor -2.100 9.8e-03
ependymoma -3.300 4.3e-03
glioblastoma -2.200 2.2e-03
group 4 medulloblastoma 2.200 4.1e-02
lung carcinoma 3.000 9.4e-38
medulloblastoma, large-cell -2.500 4.7e-02
oligodendroglioma -2.500 7.0e-03
pediatric high grade glioma -2.100 1.3e-02
Pick disease -1.400 4.2e-02
primitive neuroectodermal tumor -3.200 4.1e-03
psoriasis -1.600 7.0e-23

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (3)

AA Sequence

MKKMSNIYESAANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTEVIRTC      1 - 70
INPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGK     71 - 140
SSITVIAEELSGNDDYVELAFNARKLDDKDFFSKSDPFLEIFRMNDDATQQLVHRTEVVMNNLSPAWKSF    141 - 210
KVSVNSLCSGDPDRRLKCIVWDWDSNGKHDFIGEFTSTFKEMRGAMEGKQVQWECINPKYKAKKKNYKNS    211 - 280
GTVILNLCKIHKMHSFLDYIMGGCQIQFTVAIDFTASNGDPRNSCSLHYIHPYQPNEYLKALVAVGEICQ    281 - 350
DYDSDKMFPAFGFGARIPPEYTVSHDFAINFNEDNPECAGIQGVVEAYQSCLPKLQLYGPTNIAPIIQKV    351 - 420
AKSASEETNTKEASQYFILLILTDGVITDMADTREAIVHASHLPMSVIIVGVGNADFSDMQMLDGDDGIL    421 - 490
RSPKGEPVLRDIVQFVPFRNFKHASPAALAKSVLAEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP       491 - 557
//

Text Mined References (13)

PMID Year Title