Property Summary

Ligand Count 2
NCBI Gene PubMed Count 41
PubMed Score 133.19
PubTator Score 61.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Endometriosis 1.452 1.5e-02
active Crohn's disease -1.125 3.1e-02
active ulcerative colitis -1.266 4.6e-02
adult high grade glioma 1.600 7.6e-03
Atopic dermatitis -1.300 9.5e-04
breast carcinoma -1.200 4.5e-02
colon cancer -1.900 1.7e-03
cystic fibrosis 1.570 3.3e-05
ductal carcinoma in situ -2.100 1.2e-02
glioblastoma 2.000 1.6e-02
group 3 medulloblastoma -1.400 2.7e-02
head and neck cancer and chronic obstruc... 1.100 1.5e-02
interstitial cystitis 1.200 1.2e-02
intraductal papillary-mucinous adenoma (... -2.200 5.5e-03
invasive ductal carcinoma 1.170 1.3e-03
lung adenocarcinoma -1.200 2.6e-03
lung cancer -2.800 2.0e-04
lung carcinoma -3.200 3.8e-29
medulloblastoma, large-cell -1.600 6.4e-05
non-small cell lung cancer -2.256 6.1e-13
osteosarcoma -1.285 2.3e-02
ovarian cancer 1.100 4.7e-04
pancreatic ductal adenocarcinoma liver m... -1.206 7.4e-04
Pick disease 1.100 1.5e-03

Protein-protein Interaction (1)

Gene RIF (13)

AA Sequence

MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHR      1 - 70
IGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYY     71 - 140
SIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKTETFVLSANLHGGALVASYPFDNGVQATGAL    141 - 210
YSRSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFEITL    211 - 280
ELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGE    281 - 350
YYLLLLPGSYIINVTVPGHDPHITKVIIPEKSQNFSALKKDILLPFQGQLDSIPVSNPSCPMIPLYRNLP    351 - 420
DHSAATKPSLFLFLVSLLHIFFK                                                   421 - 443
//

Text Mined References (43)

PMID Year Title