Property Summary

NCBI Gene PubMed Count 40
PubMed Score 127.70
PubTator Score 61.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Endometriosis 1.452 1.5e-02
osteosarcoma -2.422 3.4e-08
cystic fibrosis 1.570 3.3e-05
glioblastoma 2.000 1.6e-02
medulloblastoma, large-cell -1.600 6.4e-05
Atopic dermatitis -1.300 9.5e-04
pancreatic ductal adenocarcinoma liver m... -1.206 7.4e-04
non-small cell lung cancer -2.534 2.9e-16
intraductal papillary-mucinous adenoma (... -2.200 5.5e-03
lung cancer -4.800 1.2e-07
colon cancer -1.900 1.7e-03
active Crohn's disease -1.125 3.1e-02
active ulcerative colitis -1.396 1.4e-02
breast carcinoma -1.200 4.5e-02
interstitial cystitis 1.200 1.2e-02
adult high grade glioma 1.600 7.6e-03
group 3 medulloblastoma -1.400 2.7e-02
lung adenocarcinoma -1.200 2.6e-03
invasive ductal carcinoma -2.400 9.7e-03
lung carcinoma -3.200 3.8e-29
Pick disease 1.700 1.8e-04
ductal carcinoma in situ -2.100 1.2e-02
ovarian cancer 1.100 4.7e-04
head and neck cancer and chronic obstruc... 1.100 1.5e-02

Protein-protein Interaction (2)

Gene RIF (12)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of carboxypeptidase M (CPM) in primary human brain microvascular endothelial cells
24108126 CPM binding to extracellular loop 2 of the B1R results in positive allosteric modulation of B1R signaling, and disruption of this interaction could provide a novel therapeutic approach to reduce pathological B1R signaling.
23172796 Carboxypeptidase M expression is lost in human renal cell carcinoma tumor cells, whereas it is abundant in tumor-associated foam cells and neovasculature.
22157720 novel marker and cellular player in lipid uptake and/or metabolism of activated macrophages by promoting foam cell formation
21454694 CPM and B1Rs on cell membranes form a critical complex that potentiates B1R signaling.
20673876 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19820690 CPM amplification could be used as an alternative diagnostic tool for the diagnosis of well-differentiated liposarcoma/atypical lipomatous tumors.
18292211 Cleavage of the C-terminal lysine residue of SDF-1alpha by CPM leads to attenuated chemotactic responses.
18187413 Carboxypeptidase M and kinin B1 receptors interact to facilitate efficient b1 signaling from B2 agonists
15066430 Results report the crystallization of human carboxypeptidase M and its 3.0 angstrom crystal structure.
12457462 CPM is membrane-bound via attachment of glycosylphosphatidylinositol at Ser406. Glu264 is a critical catalytic residue, whereas Glu260 affects stability and substrate kinetics.
11891060 Multiple transcription start sites in two regions ~30 kb apart are flanked by two unique functional promoters. Five major types of transcripts resulting from multiple transcription start sites and alternate splicing in the 5-prime region were identified.

AA Sequence

MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHR      1 - 70
IGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYY     71 - 140
SIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKTETFVLSANLHGGALVASYPFDNGVQATGAL    141 - 210
YSRSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFEITL    211 - 280
ELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGE    281 - 350
YYLLLLPGSYIINVTVPGHDPHITKVIIPEKSQNFSALKKDILLPFQGQLDSIPVSNPSCPMIPLYRNLP    351 - 420
DHSAATKPSLFLFLVSLLHIFFK                                                   421 - 443
//

Text Mined References (42)

PMID Year Title
24986923 2014 A genome-wide association study identifies susceptibility loci of silica-related pneumoconiosis in Han Chinese.
24108126 2013 Carboxypeptidase M is a positive allosteric modulator of the kinin B1 receptor.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23172796 2013 Mapping of carboxypeptidase m in normal human kidney and renal cell carcinoma: expression in tumor-associated neovasculature and macrophages.
22157720 2012 Carboxypeptidase-M is regulated by lipids and CSFs in macrophages and dendritic cells and expressed selectively in tissue granulomas and foam cells.
21454694 2011 Cross-talk between carboxypeptidase M and the kinin B1 receptor mediates a new mode of G protein-coupled receptor signaling.
20673876 2010 Genome-wide association-, replication-, and neuroimaging study implicates HOMER1 in the etiology of major depression.
19820690 2009 Carboxypeptidase M: a biomarker for the discrimination of well-differentiated liposarcoma from lipoma.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18292211 2008 Carboxypeptidase M expressed by human bone marrow cells cleaves the C-terminal lysine of stromal cell-derived factor-1alpha: another player in hematopoietic stem/progenitor cell mobilization?
18187413 2008 Carboxypeptidase M and kinin B1 receptors interact to facilitate efficient b1 signaling from B2 agonists.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16602701 2006 Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15066430 2004 Crystal structure of human carboxypeptidase M, a membrane-bound enzyme that regulates peptide hormone activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517339 2003 Proteomic analysis of glycosylphosphatidylinositol-anchored membrane proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12457462 2003 Effect of mutation of two critical glutamic acid residues on the activity and stability of human carboxypeptidase M and characterization of its signal for glycosylphosphatidylinositol anchoring.
11934264 2002 Molecular structure and alternative splicing of the human carboxypeptidase M gene.
11891060 2002 Structure of the human carboxypeptidase M gene. Identification of a proximal GC-rich promoter and a unique distal promoter that consists of repetitive elements.
11444929 2001 Expression and activity of ectopeptidases in fibrillating human atria.
11375929 2001 Diverse transcriptional initiation revealed by fine, large-scale mapping of mRNA start sites.
11147789 2001 Type 2 diabetes locus on 12q15. Further mapping and mutation screening of two candidate genes.
10849748 2000 The membrane-bound ectopeptidase CPM as a marker of macrophage maturation in vitro and in vivo.
10426564 1999 Membrane-bound cell surface peptidases in reproductive organs.
10222261 1999 Release of glycosylphosphatidylinositol-anchored carboxypeptidase M by phosphatidylinositol-specific phospholipase C upregulates enzyme synthesis.
9701794 1998 Membrane-bound carboxypeptidase-M is expressed on human ovarian follicles and corpora lutea of menstrual cycle and early pregnancy.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8796265 1996 Membrane anchoring and release of carboxypeptidase M: implications for extracellular hydrolysis of peptide hormones.
8635221 1996 Removal of Arg141 from the alpha chain of human hemoglobin by carboxypeptidases N and M.
8586455 1995 Physical map location of the human carboxypeptidase M gene (CPM) distal to D12S375 and proximal to D12S8 at chromosome 12q15.
8338689 1993 High concentration of carboxypeptidase M in lungs: presence of the enzyme in alveolar type I cells.
7797563 1995 Carboxypeptidase M is identical to the MAX.1 antigen and its expression is associated with monocyte to macrophage differentiation.
7620164 1995 Distribution of carboxypeptidase M on lymphoid and myeloid cells parallels the other zinc-dependent proteases CD10 and CD13.
7615511 1995 Extracellular conversion of epidermal growth factor (EGF) to des-Arg53-EGF by carboxypeptidase M.
2914904 1989 Human carboxypeptidase M. Purification and characterization of a membrane-bound carboxypeptidase that cleaves peptide hormones.
2753907 1989 Molecular cloning and sequencing of the cDNA for human membrane-bound carboxypeptidase M. Comparison with carboxypeptidases A, B, H, and N.
1431901 1992 Carboxypeptidase M in brain and peripheral nerves.