Property Summary

NCBI Gene PubMed Count 8
PubMed Score 26.77
PubTator Score 0.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEYEEYQKQLVEEKMERDAQFTQRKAERA      1 - 70
TLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDK     71 - 140
AQATLGDLKQSAEKCHVM                                                        141 - 158
//

Text Mined References (10)

PMID Year Title