Property Summary

NCBI Gene PubMed Count 34
PubMed Score 47.53
PubTator Score 38.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -2.400 3.5e-19
ependymoma -4.100 8.1e-26
glioblastoma -3.600 8.0e-09
oligodendroglioma -2.200 1.1e-14
group 3 medulloblastoma -2.800 5.9e-04
atypical teratoid / rhabdoid tumor -3.900 3.0e-11
medulloblastoma, large-cell -2.500 4.9e-05
primitive neuroectodermal tumor -2.400 5.0e-04
lung cancer 4.500 1.6e-06
pediatric high grade glioma -3.500 5.6e-09
pilocytic astrocytoma -3.900 1.1e-11
subependymal giant cell astrocytoma -3.587 3.1e-03
lung carcinoma 3.500 2.2e-49
Pick disease -1.100 4.8e-02
psoriasis -1.800 6.5e-08

Gene RIF (14)

PMID Text
25692331 These results suggested that CPLX2 participated in synaptic taste transduction.
25564026 CPLX2 rs1366116*T variant represents a risk factor of schizophrenia, and , at the same time, CPLX2 rs3892909*T variant is protective against schizophrenia (study performed in Armenians).
25297695 Then results indicated that CPLX2 may be involved in the etiology of schizophrenia and one of its potential biological mechanisms by studying the effects of CPLX2 risk variants on working memory load-dependent neural activity in a frontoparietal network.
20819981 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
18240322 CX2 level increased between the fetal and the 6-10 years groups and then plateaued
16442780 Observational study of gene-disease association. (HuGE Navigator)
16131404 Observational study of gene-disease association. (HuGE Navigator)
15653259 In schizophrenia, complexin II was reduced in dorsolateral prefrontal cortex and superior temporal cortex. The impairment of synaptic transmission may contribute to the dysfunction of cortical neural circuits that characterises the disorder.
12807877 in huntingtin mutation, the decline in neurotransmitter release is a direct consequence of complexin II depletion
12082566 altered immunoreactivity of this protein in prefrontal cortex in severe mental illness
12058476 role in synaptic vesicle exocytosis

AA Sequence

MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKY      1 - 70
GLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK           71 - 134
//

Text Mined References (34)

PMID Year Title
25692331 2015 Expression of the synaptic exocytosis-regulating molecule complexin 2 in taste buds and its participation in peripheral taste transduction.
25564026 2014 Risk and protective effects of the complexin-2 gene and gene-environment interactions in schizophrenia.
25297695 2015 Complexin2 modulates working memory-related neural activity in patients with schizophrenia.
24951543 2014 Meta-analysis of genome-wide association studies in multiethnic Asians identifies two loci for age-related nuclear cataract.
23527680 2013 Genome-wide association study of inattention and hyperactivity-impulsivity measured as quantitative traits.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20819981 2010 Modification of cognitive performance in schizophrenia by complexin 2 gene polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18240322 2008 Regulation of complexin 1 and complexin 2 in the developing human prefrontal cortex.
16442780 2006 No association of complexin1 and complexin2 genes with schizophrenia in a Japanese population.
16162394 2005 Structural organization of the human complexin 2 gene (CPLX2) and aspects of its functional activity.
16131404 2005 Association study of polymorphisms in synaptic vesicle-associated genes, SYN2 and CPLX2, with schizophrenia.
15906159 2004 Early changes in Huntington's disease patient brains involve alterations in cytoskeletal and synaptic elements.
15653259 2005 Decreased expression of vesicular glutamate transporter 1 and complexin II mRNAs in schizophrenia: further evidence for a synaptic pathology affecting glutamate neurons.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12807877 2003 Expression of mutant huntingtin blocks exocytosis in PC12 cells by depletion of complexin II.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200427 2002 Action of complexin on SNARE complex.
12082566 2002 Altered immunoreactivity of complexin protein in prefrontal cortex in severe mental illness.
12058476 2002 [The mechanism of neurotransmitter release: role of synaphin/complexin in synaptic vesicle exocytosis].
11751907 2002 Rapid and selective binding to the synaptic SNARE complex suggests a modulatory role of complexins in neuroexocytosis.
11576753 2001 Synaptic pathology in the anterior cingulate cortex in schizophrenia and mood disorders. A review and a Western blot study of synaptophysin, GAP-43 and the complexins.
11483314 2001 Cerebellar synaptic protein expression in schizophrenia.
10777504 2000 Selective interaction of complexin with the neuronal SNARE complex. Determination of the binding regions.
10430466 1999 Immunohistochemical distribution of the two isoforms of synaphin/complexin involved in neurotransmitter release: localization at the distinct central nervous system regions and synaptic types.
10051208 1999 Distinct regional distribution in the brain of messenger RNAs for the two isoforms of synaphin associated with the docking/fusion complex.
9853440 1998 Preferential involvement of excitatory neurons in medial temporal lobe in schizophrenia.
8824312 1996 A SNARE complex containing syntaxin 3 is present in ribbon synapses of the retina.
7553862 1995 Complexins: cytosolic proteins that regulate SNAP receptor function.
605033 1977 Effect of time of day of insemination and the position of the egg in the oviduct on the fertility of turkeys.