Property Summary

NCBI Gene PubMed Count 26
PubMed Score 76.06
PubTator Score 26.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -2.300 1.7e-13
posterior fossa group B ependymoma -5.400 1.5e-16
glioblastoma -4.000 3.7e-11
oligodendroglioma -2.000 8.3e-09
group 3 medulloblastoma -3.900 7.1e-10
atypical teratoid/rhabdoid tumor -4.900 4.9e-17
medulloblastoma, large-cell -2.500 2.9e-04
primitive neuroectodermal tumor -3.400 1.6e-05
interstitial cystitis 1.100 7.1e-04
pediatric high grade glioma -4.000 3.7e-08
pilocytic astrocytoma -4.900 1.5e-11
Pick disease -1.800 8.7e-03

Protein-protein Interaction (8)

Gene RIF (12)

PMID Text
26603934 Collectively these results demonstrate that CPX-1 is a secreted collagen-binding glycoprotein and provide a foundation for future studies investigating the function of CPX-1.
26245303 Studies indicate the role of the small regulatory factor complexin in Ca(2+)-dependent vesicle fusion and exocytosis.
25831964 Data support the the trans insertion model for complexin clamping.
22705946 Together with synaptotagmin 1, complexin synchronizes and stimulates rapid fusion of accumulated docked vesicles in response to physiological Ca(2+) concentrations.
21785414 The 'central helix' of complexin is anchored to one SNARE complex, while its 'accessory helix' extends away at ~45 degrees and bridges to a second complex, occupying the vacant v-SNARE binding site to inhibit fusion.
21785412 The crystal structure of complexin bound to a prefusion SNAREpin mimetic shows that the accessory helix extends away from the SNAREpin in an 'open' conformation, binding another SNAREpin and inhibiting its assembly, to clamp fusion.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18240322 CX1 level increased progressively across development
16794037 description of what may represent a basic principle of the coupling mechanism in SNARE dependent exocytosis: a reversible clamping protein, complexin, that can freeze the SNAREpin, an assembled fusion-competent intermediate en route to fusion
16442780 Observational study of gene-disease association. (HuGE Navigator)
12082566 altered immunoreactivity of this protein in prefrontal cortex in severe mental illness
12058476 role in synaptic vesicle exocytosis

AA Sequence

MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKY      1 - 70
GIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK           71 - 134
//

Text Mined References (27)

PMID Year Title
26603934 2015 Carboxypeptidase X-1 (CPX-1) is a secreted collagen-binding glycoprotein.
26245303 2015 Complexins: small but capable.
25831964 2015 Re-visiting the trans insertion model for complexin clamping.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
22705946 2012 Complexin arrests a pool of docked vesicles for fast Ca2+-dependent release.
21785414 2011 Complexin cross-links prefusion SNAREs into a zigzag array.
21785412 2011 A conformational switch in complexin is required for synaptotagmin to trigger synaptic fusion.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
18240322 2008 Regulation of complexin 1 and complexin 2 in the developing human prefrontal cortex.
16794037 2006 A clamping mechanism involved in SNARE-dependent exocytosis.
16722236 2006 The role of SNARE proteins in trafficking and function of neurotransmitter transporters.
16442780 2006 No association of complexin1 and complexin2 genes with schizophrenia in a Japanese population.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15526345 2004 Proteome analysis of human substantia nigra in Parkinson's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12082566 2002 Altered immunoreactivity of complexin protein in prefrontal cortex in severe mental illness.
12058476 2002 [The mechanism of neurotransmitter release: role of synaphin/complexin in synaptic vesicle exocytosis].
11832227 2002 Three-dimensional structure of the complexin/SNARE complex.
11483314 2001 Cerebellar synaptic protein expression in schizophrenia.
10051208 1999 Distinct regional distribution in the brain of messenger RNAs for the two isoforms of synaphin associated with the docking/fusion complex.
9853440 1998 Preferential involvement of excitatory neurons in medial temporal lobe in schizophrenia.
7654227 1995 Synaphin: a protein associated with the docking/fusion complex in presynaptic terminals.
7553862 1995 Complexins: cytosolic proteins that regulate SNAP receptor function.