Property Summary

NCBI Gene PubMed Count 21
PubMed Score 21.21
PubTator Score 18.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.000 7.9e-05
astrocytic glioma -4.200 1.7e-03
Astrocytoma, Pilocytic -1.400 3.2e-05
atypical teratoid / rhabdoid tumor -2.000 3.3e-05
Breast cancer -1.200 5.6e-04
colon cancer -1.100 2.6e-02
ependymoma -5.200 6.9e-04
glioblastoma -1.900 3.2e-10
group 3 medulloblastoma -1.500 1.1e-02
limb girdle muscular dystrophy 2B -1.144 5.1e-04
lung cancer -1.100 1.4e-03
lung carcinoma 1.300 2.9e-35
medulloblastoma, large-cell -1.900 1.5e-05
oligodendroglioma -3.800 9.4e-03
osteosarcoma -2.502 9.0e-08
ovarian cancer -1.100 3.1e-04
pancreatic ductal adenocarcinoma liver m... -1.976 5.9e-04
primitive neuroectodermal tumor -2.700 2.2e-02

Gene RIF (11)

AA Sequence

MQDDLLMDKSKTQPQPQQQQRQQQQPQPESSVSEAPSTPLSSETPKPEENSAVPALSPAAAPPAPNGPDK      1 - 70
MQMESPLLPGLSFHQPPQQPPPPQEPAAPGASLSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFP     71 - 140
HHVNPVFGGTFSPQIGLAQTQHHQQPPPPAPAPQPAQPAQPPQAQPPQQRRSPASPSQAPYAQRSAAAAY    141 - 210
GHQPIMTSKPSSSSAVAAAAAAAAASSASSSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGV    211 - 280
GVPSPLNPISPLKKPFSSNVIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLE    281 - 350
NSLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNNAFLDDSHGDQAL    351 - 420
SSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLL    421 - 490
FQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPL    491 - 560
RAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYV    561 - 630
LDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS      631 - 698
//

Text Mined References (26)

PMID Year Title