Property Summary

NCBI Gene PubMed Count 34
PubMed Score 171.08
PubTator Score 74.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (21)

PMID Text
26627607 Identify a mechanism of VEGF overexpression in liver and mesentery that promotes pathologic, but not physiologic, angiogenesis, via sequential and nonredundant functions of CPEB1 and CPEB4.
26456073 Structural Analysis of the Pin1-CPEB1 interaction and its potential role in CPEB1 degradation has been described.
26398195 CPEB1, 2, and 4, are essential to successful mitotic cell division.
25216517 Results suggest that CPEB1-mediated translational control is essential for the differentiation of GSCs.
24141422 FMRP and CPEB1, an activator of translation, are present in neuronal dendrites, are predicted to bind many of the same mRNAs and may mediate a translational homeostasis that, when imbalanced, results in fragile X syndrome.
23788032 Downregulation of CPEB1 induces senescence of glioma cells in a p53-dependent manner.
23500490 The structural similarity to other ZZ domains suggests that the CPEB1-ZZ domain recruits sumoylated proteins during assembly of the ribonucleoprotein complex prior to mRNA export from the nucleus.
23434754 results reveal a novel function of CPEB1 in mediating alternative 3'-UTR processing, which is coordinated with regulation of mRNA translation, through its dual nuclear and cytoplasmic functions
23178487 CPEB accelerates deadenylation and decay of the c-myc mRNA by recruiting the Tob-Caf1 complex.
22727665 poly(A) polymerase Gld2, deadenylase PARN, and translation inhibitory factor neuroguidin (Ngd) are components of a dendritic CPEB-associated polyadenylation apparatus
22334078 CPEB-mediated zonal occludens-1 mRNA localization is essential for tight-junction assembly and mammary epithelial cell polarity
22253608 depleted of CPEB demonstrated that this protein directly regulates the translation of PTEN and Stat3 mRNAs. Our results show that CPEB regulated translation is a key process involved in insulin signaling
22052064 The first evidence of CPEB1 involvement in GC is presented, along with the molecular mechanism underlying the regulation of its expression and its potential role in invasion and angiogenesis.
21478871 Gld4, a second non-canonical poly(A) polymerase, was found to regulate p53 mRNA polyadenylation/translation in a CPEB-dependent manner
20339377 The loss of function CPEB1 protein would enhance tumorigenesis by promoting the survival of rapidly dividing and hypermetabolic tumor cells as levels of available nutrients decline.
20144904 The authors show that the human CPEB1 can repress the activity of the reporter construct containing the HPV-16 early sequences. This repression can be counteracted by a human cytoplasmic poly(A) polymerase, hGLD-2 fused to CPEB1.
20062064 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19161537 U6snRNA, GAPDH mRNA and CPEB1 mRNA levels may be useful as tumor markers for genital cancers.
19141477 CPEB controls senescence and bioenergetics in human cells at least in part by modulating p53 mRNA polyadenylation-induced translation
18923137 Results show that CPEB1 is continuously shuttling between nucleus and cytoplasm, and its export is controlled by two redundant motifs dependent on the nuclear export receptor Crm1.
15731006 CPEB1 has a role in compartmentalization of mRNA metabolism in the cytoplasm, between dcp1 bodies and stress granules

AA Sequence

MALSLEEEAGRIKDCWDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEE      1 - 70
TVTSRMLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPLGNVLG     71 - 140
KPPLSFLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPP    141 - 210
LPFLSLSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREAR    211 - 280
LHRQAAAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPR    281 - 350
CPPKGNMPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVR    351 - 420
SPSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSA    421 - 490
AFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQ    491 - 560
KNRDSS                                                                    561 - 566
//

Text Mined References (37)

PMID Year Title
26627607 2016 Sequential Functions of CPEB1 and CPEB4 Regulate Pathologic Expression of Vascular Endothelial Growth Factor and Angiogenesis in Chronic Liver Disease.
26456073 2015 Structural Analysis of the Pin1-CPEB1 interaction and its potential role in CPEB1 degradation.
26398195 2015 Global Analysis of CPEBs Reveals Sequential and Non-Redundant Functions in Mitotic Cell Cycle.
26063658 2015 Heterozygous HTRA1 mutations are associated with autosomal dominant cerebral small vessel disease.
25216517 2014 CPEB1 modulates differentiation of glioma stem cells via downregulation of HES1 and SIRT1 expression.
24141422 2013 Genetic and acute CPEB1 depletion ameliorate fragile X pathophysiology.
23892092 2013 Exploration of deleterious single nucleotide polymorphisms in the components of human P bodies: an in silico approach.
23788032 2013 CPEB1, a histone-modified hypomethylated gene, is regulated by miR-101 and involved in cell senescence in glioma.
23776146 Specificity factors in cytoplasmic polyadenylation.
23500490 2013 The C-terminal region of cytoplasmic polyadenylation element binding protein is a ZZ domain with potential for protein-protein interactions.
23446545 2013 Translational control of cell growth and malignancy by the CPEBs.
23434754 2013 CPEB1 coordinates alternative 3'-UTR formation with translational regulation.
23178487 2014 Antiproliferative protein Tob directly regulates c-myc proto-oncogene expression through cytoplasmic polyadenylation element-binding protein CPEB.
22727665 2012 Bidirectional control of mRNA translation and synaptic plasticity by the cytoplasmic polyadenylation complex.
22334078 2012 CPEB-mediated ZO-1 mRNA localization is required for epithelial tight-junction assembly and cell polarity.
22253608 2012 Cytoplasmic polyadenylation element binding protein deficiency stimulates PTEN and Stat3 mRNA translation and induces hepatic insulin resistance.
22052064 2012 CPEB1, a novel gene silenced in gastric cancer: a Drosophila approach.
21478871 2011 CPEB and two poly(A) polymerases control miR-122 stability and p53 mRNA translation.
20339377 2010 Cytoplasmic polyadenylation element binding protein is a conserved target of tumor suppressor HRPT2/CDC73.
20144904 2010 The early noncoding region of human papillomavirus type 16 is regulated by cytoplasmic polyadenylation factors.
20062064 2010 Common variants at 2q37.3, 8q24.21, 15q21.3 and 16q24.1 influence chronic lymphocytic leukemia risk.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19161537 2009 Expression of CPEB, GAPDH and U6snRNA in cervical and ovarian tissue during cancer development.
19141477 2008 CPEB regulation of human cellular senescence, energy metabolism, and p53 mRNA translation.
18923137 2009 Nucleocytoplasmic traffic of CPEB1 and accumulation in Crm1 nucleolar bodies.
18752464 2009 Cytoplasmic polyadenylation-element-binding protein (CPEB)1 and 2 bind to the HIF-1alpha mRNA 3'-UTR and modulate HIF-1alpha protein expression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15966895 2005 Over-expression of Aurora-A targets cytoplasmic polyadenylation element binding protein and promotes mRNA polyadenylation of Cdk1 and cyclin B1.
15731006 2005 The translational regulator CPEB1 provides a link between dcp1 bodies and stress granules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11433366 2001 Translational control by CPEB: a means to the end.
11223249 2001 Identification and characterization of the gene encoding human cytoplasmic polyadenylation element binding protein.
9847074 1998 Toward a complete human genome sequence.