Property Summary

NCBI Gene PubMed Count 190
PubMed Score 639.12
PubTator Score 514.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.384 2.2e-02
non-small cell lung cancer -4.878 2.1e-34
lung cancer -3.700 1.1e-04
lung adenocarcinoma -3.300 7.9e-20
lung carcinoma -1.500 3.0e-03
ovarian cancer 1.200 1.2e-08
psoriasis -1.500 2.3e-06

Gene RIF (186)

PMID Text
26341360 Arg12-Glu28 and Cys383-Val401 in TAFI are involved in thrombomodulin-mediated TAFI activation. Gly205-Asp232 is involved in binding to thrombin.
26340515 Acute myocardial infarction patients have higher plasma CPU levels and lower proCPU levels than controls. This finding indicates in vivo generation of functional active CPU in patients with AMI.
26340319 CPB2 polymorphisms (reference sequences: rs1926447 and rs3742264) were related to systemic complications in bacterial meningitis. TAFI levels correlated positively with CSF complement. rs1926447 (TT) was associated with higher levels of TAFI in CSF.
26118976 TAFI deficiency results in increased brain damage in a model of thrombolysis after ischemic stroke, which was not associated with bleeding but with neuronal degeneration and MP production.
26071134 the associations between three TAFI variants -438G/A, 505G/A and 1040C/T and the risk of venous thrombosis; there was a significant association between 505G/A and the risk of disease (Meta-Analysis)
26062599 Pro-inflammatory cytokines or lipopolysaccharide decreased TAFI protein levels via binding of tristetraprolin to the CPB2 3'-UTR, which mediates CPB2 mRNA destabilisation. HuR can bind the CBP2 3'UTR. This is reduced by pro-inflammatory mediators.
25773535 Generated stable deletion mutant of TAFI with full carboxypeptidase activity without activation.
25396763 High plasma TAFI level is associated with the increasing risk of T2DM.
25193405 Neither intact TAFI nor activation peptide of TAFI can discriminate venous thromboembolism patients from healthy controls.
25066897 Arg12 of TAFI plays an important role in thrombomodulin-mediated TAFI activation by thrombin
25042727 Review/Meta-analysis: failed to confirm the influence of Ala147Thr and Thr325Ile TAFI variants on the susceptibility to CVD. Increased risk of CHD was detected in TAFI Ile325 allele carriers.
25001244 PAI-1 4G/5G polymorphism does not have any effect on occurrence of intracranial and extracranial hemorrhages in patients with FXIII deficiency, while TAFI Thr325Ile is a strong genetic risk factor.
24886076 Study provides preliminary evidence that the TAFI -2345 2G/1G and -1690 A/G polymorphisms are associated with ACI susceptibility in a Han Chinese population.
24631134 TAFI levels are independently associated to dyslipidemia and that the polymorphism rs3742264 may be related to cardiovascular risk in male subjects
24580410 High level of TAFI antigen in attack-free period of familial Mediterranean fever shows ongoing subclinical inflammation and hypercoagulability.
24354489 A significant correlation was present between TAFI Thr325Ile polymorphism in homozygous form and occurrence of spontaneous intracranial haemorrhage.
24333083 Augmentation of clot formation and anti-fibrinolysis by combining fib, FXIII and TAFI may be beneficial for the treatment of patients with severe thrombocytopenia
24252537 Our data indicate that the GTC haplotype for TAFI 505G>A/1040C>T/+1542C>G SNPs increased the risk of CVT in comparison to controls and VTE cases.
24134522 inhibition of TAFIa activity, however, was substrate-specific, because neither mAb inhibited the cleavage of thrombin-activated osteopontin and C5a by TAFIa, thus sparing the anti-inflammatory activity of TAFIa
24068025 We have demonstrated that TAFI might be a risk factor for the development of SCF independently of conventional cardiovascular risk factors.
23624357 Plasma TAFI levels and TAFI Thr325Ile genotypes were associated with breast cancer patients in Chinese Han populations and could be considered as the risk indicators of breast cancer.
23595589 TAFI is alternatively spliced in different cell types and produces intracellular forms of the protein lacking TAFIa activity
23572161 TAFI expression in HepG2 cells is reduced by nobiletin, a polymethoxyflavone in citrus fruits, through transcriptional inhibition
23327722 Plasma TAFI antigen levels were significantly higher in pregnant women with gestational diabetes mellitus when compared with controls.
23256818 Oral anticoagulants enhance both plasma and blood fibrinolysis by reducing thrombin-dependent TAFI activation, a phenomenon largely determined by low prothrombin levels.
23197299 Alterations of TAFIa-dependent prolongation of clot lysis in patients with thyroid disorders may cause an impaired haemostatic balance.
23174621 Depletion of TAFIa may contribute to the development of trauma-induced coagulopathy.
23140098 Letter: Plasmin and the thrombin-thrombomodulin complex both contribute to thrombin-activatable fibrinolysis inhibitor activation in whole blood model thrombi.
22985614 Data suggest that children with hypothyroidism exhibit increased TAFI (thrombin-activatable fibrinolysis inhibitor), decreased TFPI (tissue factor pathway inhibitor), and decreased thrombomodulin in plasma.
22938027 TAFI does not play a role in pathogenesis of the hypercoagulable state in gastric cancer patients.
22932273 genetic association study in population in China: Data suggest that one SNP in TAFI (1040C/T; not 505A/G) is strongly associated with increased risk for diabetic nephropathy; frequency of T allele is associated with increased risk in type 2 diabetes.
22931662 The t allele genotype may play a protective role in venous thromboembolism. The polymorphism of TAFI 505a/g may be not associated with VTE.
22799880 Our study is the first in the literature to determine increased TAFI levels in primary hypertension patients.
22749979 This pilot study shows that TAFI levels are inversely correlated with inflammation-associated development of complications after major trauma.
22740053 TAFI and PAI-1 have roles in fibrinolytic changes in paediatric obesity translating into a hypofibrinolytic state
22498006 Increasing the zymogen activity of TAFI results in an antifibrinolytic effect, prolonging clot lysis.
22452791 Suggest a role for tristetraprolin in constitutive, and perhaps regulated, control of TAFI mRNA stability and hence abundance.
22353215 High neutrophil elastase, low TAFI activity and PPIC in disseminated intravascular coagulation are independent predictors of patient death and MODS.
22260642 Letter: convalescent plasma TAFI-activation peptide, but not intact TAFI, showed association with future death and/or recurrent vascular events in ischemic stroke survivors.
22032800 TAFI levels were significantly lower in early recurrent fetal loss women (12.2 +/- 2.3 mug/ml vs 13.2 +/- 2.6 mug/ml in healthy controls, p=0.001).
21894805 Data provide evidence that TAFI Thr325IIe SNP (rs1926447) could be one of the genetic factors that increas the risk for myocardial infarct in the Egyptian population.
21804193 These findings suggest that plasma carboxypeptidase B plays a critical role in dampening local, C5a-mediated inflammation and represents a molecular link between inflammation and coagulation in autoimmune arthritis.
21708401 Preeclampsia by itself may be responsible for the increase in TAFIa values rather than the presence of polymorphisms.
21629966 A variety of studies have demonstrated a role for TAFI/TAFIa in venous and arterial diseases. In addition, a role in inflammation and cell migration has been shown. [review]
21622187 Recent advances in CPU research include the unravelling of the crystal structure of proCPU and revealing the molecular mechanisms for the marked instability of the active enzyme, CPU. Review.
21467042 an interaction between TAFIa and plasminogen comprises a component of the reaction mechanism, the plausibility of which was established by showing that TAFIa binds both Glu-Pg and Lys-Pg.
21297448 Significantly elevated TAFI levels in patients with multiple myeloma and higher serum TAFI levels were suggested to be associated with higher disease stage.
21195459 High TAFI levels are associated with increased risk of premature peripheral arterial disease.
21041299 PF4 is shown to inhibit activation of TAFI by thrombin-thrombomodulin
20961395 TAFI activation is one major mechanism whereby platelets make clots resistant to fibrinolysis.
20880845 Flexibility of the thrombin-activatable fibrinolysis inhibitor pro-domain enables productive binding of protein substrates.
20729722 observed increased frequency of +1040T/T genotype in a patient group, suggesting that this genotype could be potential risk factor for idiopathic idiopathic recurrent fetal loss
20729722 Observational study of gene-disease association. (HuGE Navigator)
20723026 the secretion of platelet-derived TAFI can augment the concentrations of TAFI already present in plasma to enhance attenuation of the fibrinolytic cascade
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627371 A higher concentration of TAFI is associated with a worse prognosis in reperfusion & recurrence in acute myocardial infarction treated with fibrinolysis. The C1040T SNP increases TAFI levels. This may encourage clot resistance to thrombolytic agents.
20627371 Observational study of gene-disease association. (HuGE Navigator)
20594598 increased TAFI antigen levels and impaired fibrinolysis are pathogenetic factors in preeclampsia, regardless of whether or not preeclampsia is associated with the presence of antiphospholipid antibodies.
20542541 The plasma aTAFI and thrombomodulin levels do not seem to be related with the presence of thrombosis observed in Behcet disease.
20490730 Although TAFI in plasma is elevated in antiphospholipid syndrome (APS), the study concluded that an elevated level is not likely a risk factor for thrombosis in APS patients, because of the inhibition of TAFI activation by antiphospholipid antibodies.
20447686 Observational study of gene-disease association. (HuGE Navigator)
20385790 Data show that TAFI and PAI-1 remained associated with thrombosis after extensive adjustment.
20381197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20375563 these findings implicate a critical and novel role for streptococci-bound TAFI, as it processes bradykinin to a B1R agonist at the bacterial surface and thereby may redirect inflammation from a transient to a chronic state.
20237223 balancing selection of functional variants promotes alternative exon 7 splicing
20216989 gene polymorphism is associated with the incidence and the age at onset of stroke
20216989 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20128871 Observational study of gene-disease association. (HuGE Navigator)
20088944 Dabigatran, at clinically relevant concentrations, enhances the susceptibility of plasma clots to t-PA-induced lysis by reducing TAFI activation and by altering the clot structure.
19967152 an increase in intracellular cAMP levels up-regulates TAFI expression with an elevation of mRNA levels, and the elevated mRNA levels are derived from both transcriptional and post-transcriptional regulations mediated by the AMP/PKA signaling pathway
19913121 Observational study of gene-disease association. (HuGE Navigator)
19895374 gene polymorphism and expression level do not influence pregnancy outcome in patients with antiphospholipid syndrome
19895374 Observational study of gene-disease association. (HuGE Navigator)
19874466 The decrease in proCPU concentration in the first 72 h after stroke onset correlates with more severe stroke, unfavourable stroke evolution, and poor long-term stroke outcome.
19859836 Compared with the control subjects, TAFI Ag levels were increased significantly in patients with hyperthyroidism.
19718465 a normally functioning TAFI under hyperglycaemic conditions may tip the haemostatic balance towards hypofibrinolysis, which may contribute to the development of cardiovascular diseases in type 2 diabetic patients
19699511 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19526059 Observational study of gene-disease association. (HuGE Navigator)
19416536 Findings presented here suggest that the properties of these two orthologous proteins are similar and that conclusions reached using the bovine TAFI may be extrapolated to the human TAFI protein.
19377074 Results showed that low TAFI activity levels are associated with increased risk of a first myocardial infarction in men, and the association between TAFI single nucleotide polymorphisms and myocardial infarction were inconsistent.
19377074 Observational study of gene-disease association. (HuGE Navigator)
19368913 Young overweight or obese women with polycystic ovary syndrome have increased plasma thrombin-activatable fibrinolysis inhibitor levels
19335449 the TAFI P91S, R92K and S90P variants exhibited specific impairment of activation by thrombin or thrombin-TM, thrombin alone, and thrombin alone or plasmin, respectively.
19298343 TAFI is present in the gastric mucosa and that it plays a role in the Helicobacter pylori-associated gastroduodenal disorders.
19253106 plasma levels of TAFI, PAI-1, D-dimer, AT III and thrombomodulin were significantly increased in women with polycystic ovary syndrome compared with age- and BMI-matched controls
19195685 The increased risk of thrombosis in thrombophilia patients is not only ascribable to an increased thrombin generation, but also high levels of procarboxypeptidase U and the presence of the 325Ile genotype tip the balance towards thrombotic tendency.
19074424 The roles of selected arginine and lysine residues of TAFI (Pro-CPU) in its activation to TAFIa by the thrombin-thrombomodulin complex.
19061349 Observational study of gene-disease association. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19038242 The proCPU system is not of major importance in the bleeding pathogenesis of patients with hereditary mucocutaneous hemorrhages.
19017260 The amount of activated TAFI, measured by TAFIa/TAFIai ELISA, but not of the t-TAFI is independently associated with the risk of CV death.
19017260 Observational study of gene-disease association. (HuGE Navigator)
19010784 circulating CPN/CPB and platelets may potentially contribute to regulating the bioactivity of leukocyte chemoattractant chemerin
18986391 Observational study of gene-disease association. (HuGE Navigator)
18974842 Observational study of gene-disease association. (HuGE Navigator)
18958767 Women with PCOS have impaired fibrinolysis, as reflected by increased TAFI.
18836720 four polymorphisms, HPA-I, TAFI 147Ala>Thr, methylene tetrahydrofolate reductase (MTHFR) 677 C>T, and MTHFR 1298 A>C, showed significant association with Asian-Indian stroke patients below 15 years of age
18836720 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18774564 In patients with PCOS, an oral contraceptive containing ethinyl estradiol and drospirenone increases ghrelin levels but not leptin levels in a 3-month period. Ghrelin might be related to the metabolic and androgenic changes in patients with PCOS.
18774564 Observational study of gene-disease association. (HuGE Navigator)
18722183 Purified bovine TAFI activated in the presence of a proteinaceous inhibitor renders a stable enzyme-inhibitor complex.
18683146 Observational study of gene-disease association. (HuGE Navigator)
18674955 Observational study of gene-disease association. (HuGE Navigator)
18669641 analysis of the crystal structure of thrombin-activable fibrinolysis inhibitor (TAFI) and description of the structural basis for its intrinsic activity and the short half-life of TAFIa
18612536 High TAFI levels were not associated with an increased risk of venous and arterial thromboembolism in thrombophilic families.
18563448 An oligogenic mode of inheritance for TAFI, in which CPB2 gene accounts for a proportion of the variation of the phenotype together with other unknown genes that may represent potential risk factors for thrombotic disease.
18559974 The intrinsic instability of TAFIa was studied by solving crystal structures of TAFI, a TAFI inhibitor (GEMSA) complex and a quadruple TAFI mutant (70-fold more stable active enzyme).
18513211 the region comprising alpha-helix 9 and beta-sheet 11 contributes to both human and rat TAFIa stability
18480982 TAFI may contribute to the impairment of fibrinolysis in patients with preeclampsia
18455758 Thrombin activatable fibrinolysis inhibitor (TAFI) is not associated with fetal loss, a retrospective study.
18406001 No effect of gestational diabetes on plasma thrombin-activatable fibrinolysis inhibitor (TAFI) antigen levels.
18396157 TAFI antigen shows a high level of variability in the healthy Asian Indian population.
18350479 No observed difference in tunica intima-media thickness measurements and TAFI levels between patients with polycystic ovary syndrome and healthy controls.
18341631 Observational study of gene-disease association. (HuGE Navigator)
18252711 TAFI zymogen is effective in cleaving a small substrate but does not play a role in the attenuation of fibrinolysis because of its inability to cleave plasmin-modified fibrin degradation products
18160566 The TAFI 325Thr/Thr genotype might be a possible risk factor for venous thromboembolism.
18075282 patients with biopsy-proven non-alcoholic steatohepatitis had higher PAI-1 and lower TAFI-Ag expression than controls
18063813 mainly the glycosylation at Asn86 contributes to the biochemical characteristics of TAFI
18048863 Thrombin activatable fibrinolysis inhibitor and alpha(2)-antiplasmin are not markers for recanalization in patients with ischemic stroke treated with recombinant tissue-type plasminogen activator.
18021301 TAFI was decreased in meningococcal disease & septic shock, & increased in disseminated intravascular coagulation & non-survivors. The TAFI 325Ile/Ile genotype was overrepresented in patients with DIC.
17855631 single nucleotide polymorphisms, in part, contribute to variation in plasma TAFI concentrations via modulation of CPB2 gene expression through an effect on mRNA stability
17723126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17723126 TAFI and PAI-1 polymorphism determinations were performed by restriction fragment length polymorphism mapping and conventional sequencing
17690487 TAFI antigen levels were decreased in patients with hyperthyroidism
17673703 TAFI and CPB modulate the plasminogen system both in the matrix and on the cell surface, thus leading to the inhibition of endothelial cell movement and tube formation.
17666015 alpha-helix 9 and beta-sheet 11 are critical for TAFIa (in)stability
17644733 TAFI activation appears to play a key role in the extent of fibrin(ogen) consumption during E coli challenge.
17636471 Observational study of gene-disease association. (HuGE Navigator)
17636471 T/T(1040C/T) homozygotes of TAFI gene had about half the probability of developing oral cancer (O.R. 0.39, 95%) when compared with C/C homozygotes
17473579 elevated TAFI antigen levels may be a consequence of an acute phase reaction, and together with a depressed overall fibrinolysis potential suggest impaired fibrinolysis in patients with acute ischemic stroke
17388801 TAFIa, PAI-1 and alpha-antiplasmin have complementary roles in regulating lysis of thrombi and plasma clots
17327284 The GG genotype of the C1542G polymorphism of TAFI displays risk factors for the manifestation of thrombotic microangiopathies.
17272741 TAFI levels show independent association with overall ischemic stroke. TAFI genotypes and haplotypes showed significant associations with both TAFI measurements. No association was observed between genetic variants and overall ischemic stroke.
17264944 Observational study of gene-disease association. (HuGE Navigator)
17138567 Exhibits continuous and stable carboxypeptidase activity against large peptide substrates, suggesting that the activity down-regulates fibrinolysis in vivo.
17107352 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16894472 TAFI has a role in coronary artery disease
16540154 TAFI is a physiological constituent of amniotic fluid. It is possible that TAFI is partially accountable for the antifibrinolytic potential of amniotic fluid
16504676 TAFI concentrations and enhanced thrombin generation in hypertensive kidney transplant recipients may contribute to the hypofibrinolysis and progressive atherosclerosis in this population.
16441664 Results demonstrate the importance of carboxypeptidase U (CPU) stability over proCPU concentration in down-regulating fibrinolysis.
16244771 results of this study showed for the first time that TAFI activity is increased in patients with clonal thrombocytosis
16123492 Metabolic syndrome and hypercholesteremia synsynergistically accelerates inflammation and impairment of fibrinolysis via elevated concentrations of TAF1, which inhibit fibrinolyaia.
15978108 Thrombin-activatable fibrinolysis inhibitor gene polymorphisms are strongly associated to plasma TAFI levels, but their role in coronary heart disease risk is not established in this study
15719893 Activation of pro-TAFI by plasmin may be a feedback mechanism that counterbalances increased fibrinolysis in patients with bleeding disorders
15692247 Thrombin Activatable Fibrinolysis Inhibitor (TAFI) plays an important role in a delicate balance between coagulation and fibrinolysis determines the stability of the fibrin clot.
15668188 High TAFI levels might possibly contribute to the thrombotic tendency in Behcet's disease.
15550029 IL-1beta plus IL-6 decreased stability of the TAFI transcript produced using the 3'-most polyadenylation site and also resulted in profound shifts in the relative abundances of the respective polyadenylated forms
15543330 there is a significant increase in TAFI levels, which translates into increased clot lysis time during pregnancy; changes in TAFI contribute to the increasing APCR of pregnancy
15521922 Observational study of gene-disease association. (HuGE Navigator)
15497025 TAFI levels increased significantly at 24- and 72-hour time points in burn, septic injury, and burn+septic injury groups
15333035 Observational study of gene-disease association. (HuGE Navigator)
15224354 study suggests that thrombin-activatable fibrinolysis inhibitor, in part secreted from lung cancer cells, may play a role in the pathogenesis of thrombotic disorders in lung cancer patients
15128744 the down-regulation of fibrinolysis mediated by basic carboxypeptidase B involves a threshold mechanism
15025077 TAFI has a role in coagulation and fibrinolysis, and could be targeted with antifibrinolytic agents [editorial]
15004439 thrombin activatable fibrinolysis inhibitor (TAFI) activity seemed to increase progressively until around 20 weeks of gestation, then maintained a moderately elevated level until delivery, and promptly decreased after delivery
14739223 A high TAFI level was associated with a 2-fold higher risk for recurrence of thrombosis; data also support the concept of a linkage between fibrinolysis and the coagulation system
14717966 prevalence of the Thr325Ile dimorphism in the TAFI gene in 50 patients who survived meningococcal disease, in 176 first-degree relatives of a consecutive patient series with meningococcal disease and 212 controls from the same geographic region
14715654 a novel mechanism was identified whereby TAFIa can modulate plasmin levels by increasing the susceptibility of plasmin to inhibition by antiplasmin.
14525995 examined the effect of activated TAFI in modulating the proinflammatory functions (e.g.,cell adhesion, neutrophil activation) of bradykinin, complement C5a, and thrombin-cleaved osteopontin
14517491 investigated hypothesis that hyperbaric exposure increases fibrinolytic activity; hyperbaric exposure followed by decompression did not alter TAFI level in blood
12958613 investigate the hypothesisis that TAFI -438 G/A and factor XIIIA Val34Leu polymorphisms might influence the formation and fate of emboli and accordingly the risk of pulmonary embolism in a case control study
12941043 TAFIa inhibited lysis of model thrombi and plasma clots by uPA, scuPA and tPA, which could be partially overcome by plasminogen, consistent with TAFIa exerting its effect through modifying the binding of plasminogen and tPA to fibrin.
12876631 TAFI gene polymorphisms (Ala147Thr, Thr325Ile and -438A/G) in both promoter & coding regions seem to be involved (both independently & additively) in the regulation of plasma TAFI Ag levels suggesting regulation on both transcriptional & protein levels.
12871455 Plasma levels of TAFI were not elevated in pulmonary embolism, except in cases with a high clot burden, suggesting that TAFI levels might be secondarily increased by release from activated platelets.
12830006 plasma hyperfibrinolysis in cirrhosis is largely due to a defective TAFIa generation resulting from low TAFI levels and probably from impaired thrombin gener
12799375 mutations in substrate binding site alter its substrate specificity
12645517 there is a functional glucocorticoid response element (GRE) in the human TAFI promoter which is capable of binding the glucocorticoid receptor
12624641 Observational study of gene-disease association. (HuGE Navigator)
12624641 Association between TAFI antigen and Ala147Thr polymorphism of the TAFI gene and angina pectoris incidence.
12595308 results establish the presence of thrombin activatable fibrinolysis inhibitor(TAFI) in platelets and suggest a role for platelet-derived TAFI in the protection of the clot against fibrinolysis
12574207 increased plasma level of TAFI may be involved in the mechanism of vascular endothelial damage in patients with type 2 diabetes mellitus.
12368162 TAFI may play a role in the development of venous thromboembolism in factor V Leiden carriers
12362237 Decreased TAFI does not contribute to the impairment of fibrinolysis in patients with preeclampsia and/or intrauterine fetal growth retardation.
12165290 TAFIa is increased in patients with APC resistance due to FV Leiden mutation, indicating that downregulation of fibrinolysis may be a factor in thrombosis.
12087030 There is an association between levels and activated protein C in normotensive type 2 diabetic patients.
12006404 Observational study of gene-disease association. (HuGE Navigator)
11903334 Observational study of gene-disease association. (HuGE Navigator)
11903334 TAFI may provide a link between coagulation and blood pressure regulation
11786552 residues in the P6-P'3 region of TAFI do not determine the thrombomodulin dependence of activation
11776333 Ala147Thr and C+1542G polymorphisms in the TAFI gene are not asssociated with a higher risk of venous thrombosis in FV Leiden carriers.
11686324 PCI can up regulate TAFI activation by inhibiting the protein C activation. PCI may therefore be an important regulator in the balance between coagulation and fibrinolysis by differentially inhibiting the activation of TAFI and of protein C.
11686322 Protein S inhibits TAFI activation in two ways.
11686321 Weinvestigated the role of TAFI in haemophilia A by measuring the clot lysis times of tissue-factor-induced fibrin formation and tPA mediated fibrinolysis.
11410415 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHF      1 - 70
FVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERH     71 - 140
PDMLTKIHIGSSFEKYPLYVLKVSGKEQAAKNAIWIDCGIHAREWISPAFCLWFIGHITQFYGIIGQYTN    141 - 210
LLRLVDFYVMPVVNVDGYDYSWKKNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETYCG    211 - 280
LYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKISKN    281 - 350
TRYTHGHGSETLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVI    351 - 420
RNV                                                                       421 - 423
//

Text Mined References (195)

PMID Year Title
26341360 2015 Selective modulation of thrombin-activatable fibrinolysis inhibitor (TAFI) activation by thrombin or the thrombin-thrombomodulin complex using TAFI-derived peptides.
26340515 2015 Plasma levels of carboxypeptidase U (CPU, CPB2 or TAFIa) are elevated in patients with acute myocardial infarction.
26340319 2015 Thrombin-activatable fibrinolysis inhibitor influences disease severity in humans and mice with pneumococcal meningitis.
26118976 2015 Lack of TAFI increases brain damage and microparticle generation after thrombolytic therapy in ischemic stroke.
26071134 2015 Impact of genetic polymorphisms in thrombin activatable fibrinolysis inhibitor (TAFI) on venous thrombosis disease: A meta-analysis.
26062599 2015 Pro-inflammatory cytokines reduce human TAFI expression via tristetraprolin-mediated mRNA destabilisation and decreased binding of HuR.
25773535 2015 Generation of a stable thrombin-activatable fibrinolysis inhibitor deletion mutant exerting full carboxypeptidase activity without activation.
25396763 2015 Effect of single nucleotide polymorphism in thrombin-activatable fibrinolysis inhibitor on the risk of diabetic macrovascular disease.
25193405 2014 Active PAI-1 as marker for venous thromboembolism: case-control study using a comprehensive panel of PAI-1 and TAFI assays.
25066897 2014 A role for arginine-12 in thrombin-thrombomodulin-mediated activation of thrombin-activatable fibrinolysis inhibitor.
25042727 2014 Genetic variations in the thrombin-activatable fibrinolysis inhibitor gene and risk of cardiovascular disease: a systematic review and meta-analysis.
25001244 2015 Central nervous system bleeding in pediatric patients with factor XIII deficiency: a study on 23 new cases.
24886076 2014 Association between polymorphisms in the flanking region of the TAFI gene and atherosclerotic cerebral infarction in a Chinese population.
24631134 2014 Thrombin-activatable fibrinolysis inhibitor (TAFI) levels and its polymorphism rs3742264 are associated with dyslipidemia in a cohort of Brazilian subjects.
24580410 2014 Higher thrombin activatable fibrinolysis inhibitor levels are associated with inflammation in attack-free familial Mediterranean fever patients.
24354489 2014 Polymorphism of thrombin-activatable fibrinolysis inhibitor and risk of intracranial haemorrhage in factor XIII deficiency.
24333083 2014 In vitro evaluation of clot quality and stability in a model of severe thrombocytopenia: effect of fibrinogen, factor XIII and thrombin-activatable fibrinolysis inhibitor.
24252537 2014 Haplotypes of TAFI gene and the risk of cerebral venous thrombosis--a case-control study.
24134522 2013 Monoclonal antibodies targeting the antifibrinolytic activity of activated thrombin-activatable fibrinolysis inhibitor but not the anti-inflammatory activity on osteopontin and C5a.
24068025 2014 Thrombin activatable fibrinolysis inhibitor : its role in slow coronary flow.
23624357 2013 Plasma thrombin-activatable fibrinolysis inhibitor levels and its Thr325Ile polymorphism in breast cancer.
23595589 2013 The mRNA encoding TAFI is alternatively spliced in different cell types and produces intracellular forms of the protein lacking TAFIa activity.
23572161 2013 Nobiletin, a polymethoxyflavone in citrus fruits, reduces TAFI expression in HepG2 cells through transcriptional inhibition.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23327722 2013 Levels of thrombin activatable fibrinolysis inhibitor in gestational diabetes mellitus.
23256818 2013 Effect of warfarin treatment on thrombin activatable fibrinolysis inhibitor (TAFI) activation and TAFI-mediated inhibition of fibrinolysis.
23197299 2013 Thrombin-activatable fibrinolysis inhibitor in hypothyroidism and hyperthyroxinaemia.
23174621 2013 Activated thrombin-activatable fibrinolysis inhibitor (TAFIa) levels are decreased in patients with trauma-induced coagulopathy.
23140098 2013 Plasmin and the thrombin-thrombomodulin complex both contribute to thrombin-activatable fibrinolysis inhibitor activation in whole blood model thrombi.
22985614 2012 Increased thrombin-activatable fibrinolysis inhibitor and decreased tissue factor pathway inhibitor and thrombomodulin levels in children with hypothyroidism.
22938027 2012 Is there any role of thrombin activatable fibrinolysis inhibitor in the development of a hypercoagulable state in gastric cancer.
22932273 2012 Genetic variation in thrombin-activatable fibrinolysis inhibitor is associated with the risk of diabetic nephropathy.
22931662 2012 [Correlation analysis of thrombin-activatable fibrinolysis inhibitor single nucleotide polymorphism with venous thromboembolism].
22799880 2013 Thrombin activatable fibrinolysis inhibitor (TAFI) levels in hypertensive patients and a comparison of the effects of amlodipine and ramipril on TAFI levels.
22749979 2013 Thrombin-activatable fibrinolysis inhibitor (TAFI) is enhanced in major trauma patients without infectious complications.
22740053 2012 Evidence that fibrinolytic changes in paediatric obesity translate into a hypofibrinolytic state: relative contribution of TAFI and PAI-1.
22498006 2012 Increased zymogen activity of thrombin-activatable fibrinolysis inhibitor prolongs clot lysis.
22452791 2012 Identification of tristetraprolin as a factor that modulates the stability of the TAFI transcript through binding to the 3'-untranslated region.
22353215 2012 A low TAFI activity and insufficient activation of fibrinolysis by both plasmin and neutrophil elastase promote organ dysfunction in disseminated intravascular coagulation associated with sepsis.
22260642 2012 Convalescent plasma levels of TAFI activation peptide predict death and recurrent vascular events in ischemic stroke survivors.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22032800 2012 Risk of early recurrent fetal loss and levels of thrombin-activatable fibrinolysis inhibitor.
21894805 2011 Plasma thrombin-activatable fibrinolysis inhibitor levels and Thr325Ile polymorphism as a risk marker of myocardial infarction in Egyptian patients.
21804193 2011 Plasma carboxypeptidase B downregulates inflammatory responses in autoimmune arthritis.
21708401 2011 Association between genotype and plasma levels of thrombin-activated fibrinolysis inhibitor (TAFI) in the development of preeclampsia.
21629966 2011 Thrombin activatable fibrinolysis inhibitor.
21622187 2011 An update on the role of carboxypeptidase U (TAFIa) in fibrinolysis.
21467042 2011 Kinetics of activated thrombin-activatable fibrinolysis inhibitor (TAFIa)-catalyzed cleavage of C-terminal lysine residues of fibrin degradation products and removal of plasminogen-binding sites.
21297448 2011 Serum thrombin activatable fibrinolysis inhibitor levels in patients with newly diagnosed multiple myeloma.
21195459 2011 High thrombin activatable fibrinolysis inhibitor levels are associated with an increased risk of premature peripheral arterial disease.
21041299 2011 Platelet factor 4 inhibits thrombomodulin-dependent activation of thrombin-activatable fibrinolysis inhibitor (TAFI) by thrombin.
20961395 2011 The role of thrombin activatable fibrinolysis inhibitor and factor XI in platelet-mediated fibrinolysis resistance: a thromboelastographic study in whole blood.
20880845 2010 Flexibility of the thrombin-activatable fibrinolysis inhibitor pro-domain enables productive binding of protein substrates.
20729722 2010 +1040 C/T polymorphism in coding region of thrombin-activatable fibrinolysis inhibitor gene and the risk of idiopathic recurrent fetal loss.
20723026 2010 Secretion and antifibrinolytic function of thrombin-activatable fibrinolysis inhibitor from human platelets.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627371 2010 [Prognosis value of thrombin activatable fibrinolysis inhibitor concentration and C1040T polymorphism in acute myocardial infarction treated with fibrinolysis].
20594598 2010 Clot lysis time and thrombin activatable fibrinolysis inhibitor in severe preeclampsia with or without associated antiphospholipid antibodies.
20542541 2010 The plasma levels of activated thrombin activatable fibrinolysis inhibitor and thrombomodulin in Behçet disease and their association with thrombosis.
20490730 2010 Increase in plasma thrombin-activatable fibrinolysis inhibitor may not contribute to thrombotic tendency in antiphospholipid syndrome because of inhibitory potential of antiphospholipid antibodies toward TAFI activation.
20447686 2010 Genetic polymorphisms in the fibrinolytic system of placentas with massive perivillous fibrin deposition.
20385790 2010 Venous thrombosis risk associated with plasma hypofibrinolysis is explained by elevated plasma levels of TAFI and PAI-1.
20381197 2011 ACE variants and risk of intracerebral hemorrhage recurrence in amyloid angiopathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20375563 2009 Activation of TAFI on the surface of Streptococcus pyogenes evokes inflammatory reactions by modulating the kallikrein/kinin system.
20237223 2010 Polymorphisms in the CPB2 gene are maintained by balancing selection and result in haplotype-preferential splicing of exon 7.
20216989 2010 Association between the Thr325Ile polymorphism of the thrombin-activatable fibrinolysis inhibitor and stroke in the Ludwigshafen Risk and Cardiovascular Health Study.
20128871 2010 Gene variants associated with venous thrombosis: confirmation in the MEGA study.
20088944 2010 Dabigatran enhances clot susceptibility to fibrinolysis by mechanisms dependent on and independent of thrombin-activatable fibrinolysis inhibitor.
20088943 2010 Insights into the molecular inactivation mechanism of human activated thrombin-activatable fibrinolysis inhibitor.
19967152 2009 Expression of thrombin-activatable fibrinolysis inhibitor (TAFI) is up-regulated by increase in intracellular cyclic AMP levels in cultured HepG2 cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19895374 2009 Thrombin activatable fibrinolysis inhibitor and clot lysis time in pregnant patients with antiphospholipid syndrome: relationship with pregnancy outcome and thrombosis.
19874466 2010 The decrease in procarboxypeptidase U (TAFI) concentration in acute ischemic stroke correlates with stroke severity, evolution and outcome.
19859836 2009 Increased thrombin-activatable fibrinolysis inhibitor and decreased tissue factor pathway inhibitor in patients with hyperthyroidism.
19718465 2009 The effects of hyperglycaemia on thrombin-activatable fibrinolysis inhibitor.
19699511 2009 Thrombin-activatable fibrinolysis inhibitor genetic polymorphisms as markers of the type of acute coronary syndrome.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19526059 2009 Polymorphic variation of genes in the fibrinolytic system and the risk of ovarian cancer.
19416536 2009 Biochemical characterization of bovine plasma thrombin-activatable fibrinolysis inhibitor (TAFI).
19377074 2009 Low thrombin activatable fibrinolysis inhibitor activity levels are associated with an increased risk of a first myocardial infarction in men.
19368913 2010 Increased plasma thrombin-activatable fibrinolysis inhibitor levels in young obese women with polycystic ovary syndrome.
19335449 2009 Functional analysis of mutant variants of thrombin-activatable fibrinolysis inhibitor resistant to activation by thrombin or plasmin.
19298343 2009 Presence of thrombin-activatable fibrinolysis inhibitor in Helicobacter pylori-associated gastroduodenal disease.
19253106 2009 Thrombin activatable fibrinolysis inhibitor and other hemostatic parameters in patients with polycystic ovary syndrome.
19195685 2009 Procarboxypeptidase U (TAFI) contributes to the risk of thrombosis in patients with hereditary thrombophilia.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19074424 2009 The roles of selected arginine and lysine residues of TAFI (Pro-CPU) in its activation to TAFIa by the thrombin-thrombomodulin complex.
19061349 2009 Association between factor XIII single nucleotide polymorphisms and aneurysmal subarachnoid hemorrhage.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19038242 2009 Procarboxypeptidase U (TAFI) and the Thr325Ile proCPU polymorphism in patients with hereditary mucocutaneous hemorrhages.
19017260 2009 Activated thrombin activatable fibrinolysis inhibitor levels are associated with the risk of cardiovascular death in patients with coronary artery disease: the AtheroGene study.
19010784 2009 Regulation of chemerin bioactivity by plasma carboxypeptidase N, carboxypeptidase B (activated thrombin-activable fibrinolysis inhibitor), and platelets.
18986391 2008 Thrombin activatable fibrinolysis inhibitor gene polymorphisms are associated with antigenic levels in the Asian-Indian population but may not be a risk for stroke.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18958767 2008 Increased thrombin-activatable fibrinolysis inhibitor antigen levels as a clue for prothrombotic state in polycystic ovary syndrome.
18836720 2009 Prothrombotic polymorphisms, mutations, and their association with pediatric non-cardioembolic stroke in Asian-Indian patients.
18774564 2009 Thrombin-activatable fibrinolysis inhibitor polymorphisms and recurrent pregnancy loss.
18722183 2008 Structure of activated thrombin-activatable fibrinolysis inhibitor, a molecular link between coagulation and fibrinolysis.
18683146 2008 [Study on the association of thrombin activatable fibrinolysis inhibitor and the Thr325Ile and Thr147Ala polymorphisms of its encoding gene CPB2 in patients with coronary heart disease].
18674955 2009 Gene polymorphisms related to angiogenesis, inflammation and thrombosis that influence risk for oral cancer.
18669641 2008 The crystal structure of thrombin-activable fibrinolysis inhibitor (TAFI) provides the structural basis for its intrinsic activity and the short half-life of TAFIa.
18612536 2008 Absolute risk of venous and arterial thromboembolism in thrombophilic families is not increased by high thrombin-activatable fibrinolysis inhibitor (TAFI) levels.
18563448 2008 A genome-wide exploration suggests an oligogenic model of inheritance for the TAFI activity and its antigen levels.
18559974 2008 Crystal structures of TAFI elucidate the inactivation mechanism of activated TAFI: a novel mechanism for enzyme autoregulation.
18513211 2008 Conformational (in)stability of rat vs. human activated thrombin activatable fibrinolysis inhibitor.
18480982 2008 Thrombin activatable fibrinolysis inhibitor in preeclampsia and gestational hypertension throughout the gestation.
18455758 2009 Thrombin activatable fibrinolysis inhibitor (TAFI) is not associated with fetal loss, a retrospective study.
18406001 2008 Gestational diabetes has no additional effect on plasma thrombin-activatable fibrinolysis inhibitor antigen levels beyond pregnancy.
18396157 2008 TAFI antigen level variability in young healthy Asian Indians; first report from Asia.
18350479 2008 Thrombin-activatable fibrinolysis inhibitor and cardiovascular risk factors in polycystic ovary syndrome.
18341631 2008 Fibrinolytic inhibitor levels and polymorphisms in Behçet disease and their association with thrombosis.
18252711 2008 Thrombin-activable fibrinolysis inhibitor zymogen does not play a significant role in the attenuation of fibrinolysis.
18160566 2008 Association between the Thr325Ile and Ala147Thr polymorphisms of the TAFI gene and the risk of venous thromboembolic disease.
18075282 2007 Plasminogen activator inhibitor-1 and thrombin activatable fibrinolysis inhibitor levels in non-alcoholic steatohepatitis.
18063813 2008 Biochemical importance of glycosylation in thrombin activatable fibrinolysis inhibitor.
18048863 2008 Change in hemostatic markers after recombinant tissue-type plasminogen activator is not associated with the chance of recanalization.
18021301 2008 Thrombin-activatable fibrinolysis inhibitor is associated with severity and outcome of severe meningococcal infection in children.
17855631 2008 Effect of single nucleotide polymorphisms on expression of the gene encoding thrombin-activatable fibrinolysis inhibitor: a functional analysis.
17723126 2007 Influence of thrombin-activatable fibrinolysis inhibitor and plasminogen activator inhibitor-1 gene polymorphisms on tissue-type plasminogen activator-induced recanalization in ischemic stroke patients.
17690487 2007 Thrombin activatable fibrinolysis inhibitor antigen levels are inversely correlated with plasminogen activator inhibitor-1 antigen levels in hyperthyroid patients.
17673703 2007 TAFI and pancreatic carboxypeptidase B modulate in vitro capillary tube formation by human microvascular endothelial cells.
17666015 2007 Comparative evaluation of stable TAFIa variants: importance of alpha-helix 9 and beta-sheet 11 for TAFIa (in)stability.
17644733 2007 Thrombin-thrombomodulin connects coagulation and fibrinolysis: more than an in vitro phenomenon.
17636471 2007 The 1040C/T polymorphism influencing thermal stability and activity of thrombin activatable fibrinolysis inhibitor is associated with risk for oral cancer.
17473579 2007 Thrombin activatable fibrinolysis inhibitor and its relationship to fibrinolysis and inflammation during the acute and convalescent phase of ischemic stroke.
17388801 2007 TAFIa, PAI-1 and alpha-antiplasmin: complementary roles in regulating lysis of thrombi and plasma clots.
17327284 2007 Association of genotypes of thrombin-activatable fibrinolysis inhibitors with thrombotic microangiopathies--a pilot study.
17272741 2007 Thrombin activatable fibrinolysis inhibitor activation peptide shows association with all major subtypes of ischemic stroke and with TAFI gene variation.
17264944 2007 Genetic variation in thrombin-activatable fibrinolysis inhibitor (TAFI) is associated with the risk of splanchnic vein thrombosis.
17138567 2007 Thrombin-activable fibrinolysis inhibitor (TAFI) zymogen is an active carboxypeptidase.
17107352 2006 ABO blood group but not haemostasis genetic polymorphisms significantly influence thrombotic risk: a study of 180 homozygotes for the Factor V Leiden mutation.
16894472 2006 TAFI activity in coronary artery disease: a contribution to the current discussion on TAFI assays.
16540154 2007 Thrombin activatable fibrinolysis inhibitor (TAFI) in human amniotic fluid. A preliminary study.
16504676 Thrombin activatable fibrinolysis inhibitor in hypertensive kidney transplant recipients.
16445295 2006 Post-translational modifications of human thrombin-activatable fibrinolysis inhibitor (TAFI): evidence for a large shift in the isoelectric point and reduced solubility upon activation.
16441664 2006 Limited mutagenesis increases the stability of human carboxypeptidase U (TAFIa) and demonstrates the importance of CPU stability over proCPU concentration in down-regulating fibrinolysis.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16244771 2005 Plasma levels of thrombin-activatable fibrinolysis inhibitor in primary and secondary thrombocytosis.
16123492 2005 Metabolic syndrome accompanied by hypercholesterolemia is strongly associated with proinflammatory state and impairment of fibrinolysis in patients with type 2 diabetes: synergistic effects of plasminogen activator inhibitor-1 and thrombin-activatable fibrinolysis inhibitor.
15978108 2005 TAFI gene haplotypes, TAFI plasma levels and future risk of coronary heart disease: the PRIME Study.
15719893 2004 Does an enzyme other than thrombin contribute to unexpected changes in the levels of the different forms of thrombin activatable fibrinolysis inhibitor in patients with hemophilia A, hemophilia B and von Willebrand disease?
15692247 Thrombin activatable fibrinolysis inhibitor (TAFI) at the interface between coagulation and fibrinolysis.
15668188 2005 Thrombin activatable fibrinolysis inhibitor in Behçet's disease.
15550029 2004 Role of mRNA transcript stability in modulation of expression of the gene encoding thrombin activable fibrinolysis inhibitor.
15543330 2004 Thrombin activatable fibrinolysis inhibitor and its fibrinolytic effect in normal pregnancy.
15521922 2004 TAFI polymorphisms at amino acids 147 and 325 are not risk factors for cerebral infarction.
15497025 2004 Tissue factor pathway inhibitor and thrombin activatable fibrinolytic inhibitor plasma levels following burn and septic injuries in rats.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15333035 2004 Preeclampsia and its interaction with common variants in thrombophilia genes.
15224354 2004 Increased circulating levels of thrombin-activatable fibrinolysis inhibitor in lung cancer patients.
15128744 2004 The intrinsic threshold of the fibrinolytic system is modulated by basic carboxypeptidases, but the magnitude of the antifibrinolytic effect of activated thrombin-activable fibrinolysis inhibitor is masked by its instability.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15025077 2004 TAFI: a promising drug target?
15004439 2004 Changes in activity of plasma thrombin activatable fibrinolysis inhibitor in pregnancy.
14739223 2004 Thrombin-activatable fibrinolysis inhibitor and the risk for recurrent venous thromboembolism.
14717966 2004 A functional single nucleotide polymorphism in the thrombin-activatable fibrinolysis inhibitor (TAFI) gene associates with outcome of meningococcal disease.
14715654 2004 Activated thrombin-activatable fibrinolysis inhibitor reduces the ability of high molecular weight fibrin degradation products to protect plasmin from antiplasmin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525995 2003 Thrombin activatable fibrinolysis inhibitor, a potential regulator of vascular inflammation.
14517491 2003 Diving up to 60 m depth followed by decompression has no effect on pro-enzyme and total thrombin activatable fibrinolysis inhibitor antigen concentration.
12958613 2003 Frequency of the TAFI -438 G/A and factor XIIIA Val34Leu polymorphisms in patients with objectively proven pulmonary embolism.
12941043 2003 Thrombus lysis by uPA, scuPA and tPA is regulated by plasma TAFI.
12876631 2003 Association between thrombin-activatable fibrinolysis inhibitor (TAFI) and clinical outcome in patients with unstable angina pectoris.
12871455 2003 Role of thrombin activatable fibrinolysis inhibitor (TAFI) in patients with acute pulmonary embolism.
12830006 2003 Deficiency of thrombin activatable fibrinolysis inhibitor in cirrhosis is associated with increased plasma fibrinolysis.
12799375 2003 Mutations in the substrate binding site of thrombin-activatable fibrinolysis inhibitor (TAFI) alter its substrate specificity.
12645517 2003 Acute phase mediators modulate thrombin-activable fibrinolysis inhibitor (TAFI) gene expression in HepG2 cells.
12643276 2003 Stabilization versus inhibition of TAFIa by competitive inhibitors in vitro.
12624641 2003 Association between TAFI antigen and Ala147Thr polymorphism of the TAFI gene and the angina pectoris incidence. The PRIME Study (Prospective Epidemiological Study of MI).
12595308 2003 Identification of thrombin activatable fibrinolysis inhibitor (TAFI) in human platelets.
12574207 2003 Increased plasma thrombin-activatable fibrinolysis inhibitor levels in normotensive type 2 diabetic patients with microalbuminuria.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12368162 2002 Co-segregation of thrombophilic disorders in factor V Leiden carriers; the contributions of factor VIII, factor XI, thrombin activatable fibrinolysis inhibitor and lipoprotein(a) to the absolute risk of venous thromboembolism.
12362237 2002 Does thrombin activatable fibrinolysis inhibitor (TAFI) contribute to impairment of fibrinolysis in patients with preeclampsia and/or intrauterine fetal growth retardation?
12165290 2002 Thrombin-activatable fibrinolysis inhibitor antigen and TAFI activity in patients with APC resistance caused by factor V Leiden mutation.
12087030 2002 Association between plasma thrombin-activatable fibrinolysis inhibitor levels and activated protein C in normotensive type 2 diabetic patients.
12006404 2002 Plasma thrombin-activatable fibrinolysis inhibitor antigen concentration and genotype in relation to myocardial infarction in the north and south of Europe.
11686324 2001 Protein C inhibitor regulates the thrombin-thrombomodulin complex in the up- and down regulation of TAFI activation.
11686322 2001 The role of protein S in the activation of thrombin activatable fibrinolysis inhibitor (TAFI) and regulation of fibrinolysis.
11565542 2001 A novel, possibly functional, single nucleotide polymorphism in the coding region of the thrombin-activatable fibrinolysis inhibitor (TAFI) gene is also associated with TAFI levels.
11410415 2001 Identification of polymorphisms in the 5'-untranslated region of the TAFI gene: relationship with plasma TAFI levels and risk of venous thrombosis.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
10777524 2000 Inactivation of active thrombin-activable fibrinolysis inhibitor takes place by a process that involves conformational instability rather than proteolytic cleavage.
10651877 2000 A novel carboxypeptidase B that processes native beta-amyloid precursor protein is present in human hippocampus.
10574983 1999 Characterization of plasmin-mediated activation of plasma procarboxypeptidase B. Modulation by glycosaminoglycans.
10350473 1999 Characterization of the gene encoding human TAFI (thrombin-activable fibrinolysis inhibitor; plasma procarboxypeptidase B).
9869166 1998 Identification and characterization of two thrombin-activatable fibrinolysis inhibitor isoforms.
8975730 1996 The gene for human carboxypeptidase U (CPU)--a proposed novel regulator of plasminogen activation--maps to 13q14.11.
8663147 1996 TAFI, or plasma procarboxypeptidase B, couples the coagulation and fibrinolytic cascades through the thrombin-thrombomodulin complex.
8662763 1996 Activated human plasma carboxypeptidase B is retained in the blood by binding to alpha2-macroglobulin and pregnancy zone protein.
2920728 1989 Purification and properties of five different forms of human procarboxypeptidases.
1939207 1991 Isolation, molecular cloning, and partial characterization of a novel carboxypeptidase B from human plasma.
1427879 1992 The gene encoding human plasma carboxypeptidase B (CPB2) resides on chromosome 13.
17398 1977 Purification of carboxypeptidase B from human pancreas.