Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.08
PubTator Score 7.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6514 1.9e-13
diabetes mellitus 1683 7.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Amebiasis 21 3.938 2.0
Silver-Russell syndrome 38 3.137 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 7.5e-03
psoriasis 1.100 1.9e-13

Gene RIF (1)

AA Sequence

MQGTPGGGTRPGPSPVDRRTLLVFSFILAAALGQMNFTGDQVLRVLAKDEKQLSLLGDLEGLKPQKVDFW      1 - 70
RGPARPSLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYH     71 - 140
TLEEIYSWIDNFVMEHSDIVSKIQIGNSFENQSILVLKFSTGGSRHPAIWIDTGIHSREWITHATGIWTA    141 - 210
NKIVSDYGKDRVLTDILNAMDIFIELVTNPDGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGG    211 - 280
NGSNSNPCSETYHGPSPQSEPEVAAIVNFITAHGNFKALISIHSYSQMLMYPYGRLLEPVSNQRELYDLA    281 - 350
KDAVEALYKVHGIEYIFGSISTTLYVASGITVDWAYDSGIKYAFSFELRDTGQYGFLLPATQIIPTAQET    351 - 420
WMALRTIMEHTLNHPY                                                          421 - 436
//

Text Mined References (10)

PMID Year Title