Property Summary

Ligand Count 14
NCBI Gene PubMed Count 20
PubMed Score 84.13
PubTator Score 177.28

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (5)

AA Sequence

MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFP      1 - 70
SIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENP     71 - 140
HLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAIL    141 - 210
DTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFA    211 - 280
NSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNY    281 - 350
GSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHPY     351 - 419
//

Text Mined References (21)

PMID Year Title