Property Summary

NCBI Gene PubMed Count 158
PubMed Score 747.03
PubTator Score 334.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (28)

Disease log2 FC p
psoriasis -2.700 2.4e-05
interstitial lung disease 1.900 3.7e-02
astrocytoma 1.100 3.4e-04
glioblastoma 2.200 1.4e-03
osteosarcoma -6.277 9.9e-07
posterior fossa group A ependymoma 3.900 4.5e-10
atypical teratoid / rhabdoid tumor 2.600 1.5e-02
medulloblastoma, large-cell 1.400 2.0e-03
Atopic dermatitis -2.100 2.8e-04
pancreatic ductal adenocarcinoma liver m... -2.827 3.5e-02
non-small cell lung cancer 2.284 7.1e-07
colon cancer -3.300 1.6e-07
lung cancer -3.500 8.8e-05
sarcoidosis 2.400 4.8e-02
pancreatic cancer 2.600 4.6e-04
Breast cancer 2.100 3.9e-02
interstitial cystitis 2.600 2.3e-02
lung adenocarcinoma 2.959 7.7e-06
adult high grade glioma 2.200 2.6e-03
pilocytic astrocytoma 2.300 2.0e-04
primary Sjogren syndrome 1.200 1.2e-03
nasopharyngeal carcinoma -1.300 1.8e-02
Endometriosis -1.857 2.9e-02
lung carcinoma -3.300 3.6e-10
Pick disease 2.700 5.6e-03
mucosa-associated lymphoid tissue lympho... 1.637 8.1e-03
ovarian cancer 5.400 5.3e-10
pituitary cancer -2.900 1.1e-05

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (104)

PMID Text
26537957 pathological cerebrospinal fluid's environment of Parkinson's disease patients promoted the same modifications in the exogenously added ceruloplasmin
25843655 Cp-mediated neuroprotection occurs via the inhibition of seizure-associated oxidative damage.
25758665 results of this study suggest that common genetic variants of CP are associated with PD and further investigation is needed to explore their functions in Parkinson disease.
25661792 Homozygosity for c.1948G>A is described in a Dutch family with aceruloplasminemia.
25595436 sLe(x)/CP ratio tended to be higher for the pancreatic adenocarcinoma
25490030 PON-1 and ferroxidase activities in older patients with mild cognitive impairment, late onset Alzheimer's disease or vascular dementia
25463281 High ceruloplasmin levels are associated with preeclampsia.
25398823 A reduced serum FeOx activity, which can potentially lead to a rise in oxidative stress-induced biomolecular damage, seems to be a shared condition in inflammatory disorders of the central nervous system including MS.
25311416 brain microvascular endothelial cell -secreted cytokine activity increases the gene expression of neighboring C6 glioma CP, which reciprocally acts on basolateral BMVEC ferroportin to enhance brain iron import
25265377 Mercury metallation of the bacterial copper protein azurin is analogous to the one of human cerulopsmin and factor VIII in mercury poisoning.
24988611 This review describes the main role of ceruloplasmin in iron turnover is oxidizing Fe2+ into Fe3+, a process which is essential for iron binding to transferrin (the main iron-transporting protein), as well as to ferritin (the main iron-storage protein)
24799124 The core-fucosylation ratio of ceruloplasmin increases significantly in alcohol-related hepatocellular carcinoma.
24676332 we have through bioinformatic screening identified ceruloplasmin as a novel adipokine with increased expression in adipose tissue of obese subjects as well as in cells from obesity-associated cancers.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of ceruloplasmin (CP; ferroxidase) in primary human brain microvascular endothelial cells
24533165 ceruloplasmin and hepcidin differentially regulate iron efflux from brain microvascular endothelial cells
24366863 both Cp NGR sites can deamidate during aging under oxidative conditions, likely as a consequence of oxidative-induced structural changes, thereby promoting a gain of function in integrin binding, signaling, and cell adhesion.
24311705 In CKD patients, increased serum ceruloplasmin, a regulator of nitric oxide activity, is associated with increased risk of long-term adverse cardiovascular events, even after multivariable model adjustment for traditional clinical/biologic risk factors.
24282481 CP levels correlate negatively and indirectly with inflammation and fibrosis stages in male chronic hepatitis B patients.
24256706 Increased urinary excretion of plasma proteins such as IgG, ceruloplasmin and transferrin, with different molecular radii of 55 A or less and different isoelectric points precede development of microalbuminuria in patients with NIDDM and hypertension.
24118451 Findings indicate a causal role of ceruloplasmin in AF pathophysiology and suggest that ceruloplasmin might be a mediator in a specific inflammatory pathway that causally links inflammatory diseases and incidence of Atrial Fibrillation (AF).
24072069 The main result of this meta-analysis is that copper not bound to ceruloplasmin appears signi fi cantly increased in subjects with Alzheimer's disease when compared to healthy controls.
23925487 Ceruloplasmin and gelsolin are closely interacted with the oncogene NF-kappab.
23861484 Cp was associated with incident heart failure, mortality, and cardiovascular disease in the Atherosclerosis Risk in Communities population.
23812204 A novel homozygous mutation of c.2185 delC in exon 12 was found in ceruloplasmin gene in a patient with aceruloplasminemia.
23786280 Eosinophil activation occurred in early and late responses after L-ASA NPT in upper airway mucosa of AERD patients, where ApoA1, alpha2M and CP as well as CysLT may be involved in eosinophilic inflammation.
23781119 Ceruloplasmin was significantly elevated in patients with ischemic or nonischemic cardiomyopathy and had linear correlation with C-reactive protein and LVEF
23640881 Iron efflux from human brain microvasculature endothelial cells ferroportin requires the action of an exocytoplasmic ferroxidase which can be either endogenous hephaestin or extracellular ceruloplasmin.
23505556 plasma ceruloplasmin is a potential plasma biomarker of aGvHD, and it also has prognostic value for risk-adapted prophylaxis.
23344859 The diffusion of an Fe(2+) ion from the inner opening of the human H-chain ferritin to a ferroxidase site located in the interior region of the protein coat is assisted by Thr135, His136 and Tyr137.
23306200 ceruloplasmin should provide a protective shield against inadvertent oxidant production by myeloperoxidase during inflammation
23154483 Data suggest that ceruloplasmin (CP) level in serum decreases according to severity of pediatric nonalcoholic fatty liver disease (NAFLD); thus, serum CP may serve as biomarker to discriminate children with severe NAFLD.
23012398 Letter: report mutations in ceruloplasmin promoter in and possible role in iron hemostasis in patients with porphyria cutanea tarda.
22923205 study of effect of occupational exposure to lead among metallurgy workers in Poland on blood levels of transferrin (TRF), ceruloplasmin (CER) and haptoglobin (HPG): Data suggest that blood levels of copper and CER are raised with lead exposure.
22708402 change of the maintenance of three acute phase proteins: ceruloplasmin, alpha1-antitripsin and orosomucoid in an oral fluid and blood plasma at paradontitis and myocardial infarction
21901748 study to determine if genetic variations identified in CP gene contribute to oesophageal cancer (OC) pathogenesis or susceptibility in Black Xhosa-speaking South African population; statistically significant associations found for 2 of the novel variants with OC in this study and could potentially contribute to disease susceptibility
21706376 Mean substantia nigra sonographic areas were 0.31 cm(2) for Parkinson diseasse patients and 0.12 cm(2) for healthy volunteers (P < 0.001), while plasma ferroxidase activity was reduced in PD patients
21474797 Taken together, these results may suggest a functional role for ceruloplasmin in urolithiasis.
21315066 Hp phenotypes and ceruloplasmin ferroxidase activity in relation to iron store markers in patients with beta-thalassemia major
21314617 The interaction between ceruloplasmin of human plasma, and 5-lipoxygenase, the key enzyme of leukotriene synthesis, is shown for the first time
21185807 These results allow us to identify FOXO1 as a regulator of ceruloplasmin expression to promote the anti-oxidant pathway in response to IL-6 signaling.
21109502 decreased levels of serum ceruloplasmin may specifically exacerbate nigral iron deposition in patients with Parkinson's disease.
20801540 A novel homozygous ceruloplasmin mutation, c.2554+1G>T, was identified as the cause of aceruloplasminemia in three affected siblings. This mutation causes skipping of exon 14 and deletion of amino acids 809-852 while preserving the open reading frame.
20658982 Latest data on complexes of ceruloplasmin involved in inflammation.
20655381 Findings supported the notion that under low levels of hepcidin, mutant ceruloplasmin cannot stabilize ferroportin because of a loss-of-function in the ferroxidase activity.
20587610 Observational study of gene-disease association. (HuGE Navigator)
19916937 The diameter of a complex formed when LF is added to the 2CP-1MPO complex is 10.7 nm
19821764 Inhibition of osteoblast activity, mineralization, and specific gene expression is attributed to the ferroxidase activity of ferritin.
19681912 Data indicate that OxLDL showed direct associations with ceruloplasmin activity in acromegaly patients.
19670106 Urinary excretion of IgG, transferrin, and ceruloplasmin may be more sensitive indicators of glomerular capillary pressure change than albuminuria in normoalbuminuric diabetic patients.
19648144 Progeny of families with a positive history of cardiovascular diseases and/or hyperlipidemia have atherogenic lipid profile and increased ceruloplasmin levels.
19585161 Data present density functional theory optimizations of structures of dizinc(II) complexes with a model of the ferroxidase center of human H ferritin, and the results compared with the crystallographically determined structure of the complex.
19471883 A novel and one-step purification of human ceruloplasmin by acharan sulfate affinity chromatography.
19382692 Regulation of ceruloplasmin gene activity in mammary gland cells
19228837 protective role of transferrin in acute stroke and a possible ambivalent role of CP
19164917 Ceruloplasmin fragmentation is implicated in 'free' copper deregulation of Alzheimer's disease.
19159062 Younger-onset Parkinson's disease (PD) patients have significantly lower levels of serum ceruloplasmin compared to those with older-onset PD.
19095659 Dominant mutants of ceruloplasmin impair the copper loading machinery in aceruloplasminemia.
19031316 The contact between CP and MPO probably entails conformational changes close to the p-phenylenediamine binding site in CP, which explains the observed activation by MPO of the substrate's oxidation
19019832 ROS affects RNA-protein complex formation to promote Cp mRNA decay.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18952589 Antagonism of hyaluronan interactions with short-fragment hyaluronan oligomers decreased ceruloplasmin expression in parental and stem-like glioma cells in vivo and in cell culture, implying that hyaluronan regulates ceruloplasmin expression
18679377 there is an increase in ceruloplasmin levels in placental tissue in preeclampsia compared to preterm and normal controls
18388036 Ceruloplasmin is a better predictor of the long-term prognosis compared with fibrinogen, CRP, and IL-6 in patients with severe unstable angina.
18311828 Investigated of brain iron levels in two asymptomatic young adult carriers with heterozygous mutations of Cp gene by using T2*-weighted MR images.
18307039 Results describe the activity of ferroxidase, SOD1, and cofactors in CSF of patients with Parkinson's disease, Alzheimer's disease, Huntington's disease, or amyotrophic lateral sclerosis.
18293024 Multiple motor system dysfunction associated with a heterozygous ceruloplasmin gene mutation.
18200628 We report two siblings with markedly different phenotypes carrying a novel mutation: a homozygous deletion of two nucleotides (1257-1258 TT del) causing the premature stop of the Cp protein translation (Y401X).
18187043 Measurement of Cp separated by the present method could be useful for the diagnosis of ITP in the presence of thrombocytopenia and a non- or low-inflammatory state
18060472 In the cerebrospinal fluid of Alzheimer's disease patients the decrease of active CP, associated with the increase in the pool of copper not sequestered by this protein, may play a role in the neurodegenerative process
18022819 stable complex between these Cp and Hp and Tf does not occur under the experimental conditions used
17991445 The involvement of lymphocyte-derived CP on host defense processes via its anti/prooxidant properties is proposed, giving further support for a close functional interaction between the immune system and the Fe metabolism.
17965133 In contrast, apo-CP unfolds rapidly: the denatured state is reached in <2 days at 37 degrees C.
17688883 With regard to septic liver dysfunction, signs of cholestasis were mostly reflected in greater increases in Cp
17661447 In vitro equilibrium unfolding of CP involves intermediates and the copper ions are removed in stages.
17637479 The truncated mutant containing Cys-881 was able to pass through the ER and was secreted, while the truncated mutant protein without Cys-881 appeared to accumulate in the ER thus leading to ER stress and eventually resulting in cell death.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17597152 describe a study of the conformation of the human lactoferrin/ceruloplasmin complex in solution using small angle X-ray scattering
17404760 CP levels wefre determined in children with Henoch-Schonlein purpura.
17032174 ceruloplasmin gene is regulated by activator protein-1 site in the gene by redox active copper.
17013908 In a Chinese woman who had diabetes mellitus, undetectable ceruloplasmin, hand tremor, neck dystonia, and cognitive disturbances, genetic analyses revealed a novel homozygous mutation (848G > C or W283S) in exon 5 in the ceruloplasmin gene.
16831606 A biochemical analysis of the patients' serum and a biogenesis study of G969S mutant ceruloplasmin using mammalian cell culture system resulted in the synthesis and secretion of only apoceruloplasmin without any ferroxidase activity.
16775387 Results describe the biochemical features of wild-type and mutant GPI-anchored ceruloplasmin.
16756764 results showed that exposure of CP to methylglyoxal led to protein aggregation and that aggregation of CP induced the inactivation of feroxidase and the release of copper ions
16373913 Increased levels in urine predicts development of microalbuminuria in type 2 diabetes.
16150804 altered activity of ceruloplasmin may present a vulnerability factor for iron induced oxidative stress in Parkinson's disease
15752613 Cp polypeptides with molecular weight of nearly 30 kDa were found in mitochondria of HuTu 80 cells
15741220 hypoxia-inducible factor (HIF)-1 has a role in ceruloplasmin regulation
15668644 REVIEW: mechanism for the involvement of ceruloplasmin in cardiovascular disease
15648851 Observational study of genotype prevalence. (HuGE Navigator)
15557511 Observational study of gene-disease association. (HuGE Navigator)
15557511 5 new missense (I63T, P477L, T551I, R793H, T841R) & 3 new silent variations (g:9230/C->A, g:42221/C->T, g:4400/T->C) were found. Cp colocalized with Fe in Lewy bodies, suggesting a role in pathogenesis of Parkinson disease.
15111541 Urinary levels are increaed in normoalbuminuric type 2 diabetic patients.
15103512 Haptoglobin polymorphism was correlated with ceruloplasmin ferroxidase activity in a sample population of unrelated black Jordanians and activity is both haptoglobin type and concentration dependent.
12952974 data show that ceruloplasmin stimulates iron release from macrophages under hypoxic conditions by a ferroxidase-dependent mechanism
12708132 Determination of specific antioxidants like ceruloplasmin in serum may be of value in the early diagnosis of prostate and colon cancer.
12351628 elucidation of mechanisms of copper incorporation
12177070 the three-copper cluster at the N-terminal-C-terminal interface plays a crucial role in the structural stability of human ceruloplasmin
12175089 Serum levels of soluble intercellular adhesion molecule-1 (sICAM-1), ceruloplasmin (Cp), and transferrin (Tf) in rheumatoid arthritis. Serum Tf levels were significantly diminished and serum levels of sICAM-1 and Cp were significantly increased.
12132593 Carnosine, homocarnosine and anserine significantly inhibited the aggregation of CP induced by peroxyl radicals.
12029093 results show that insulin functions as a bidirectional, condition-dependent regulator of hepatic cell Cp expression; the unique regulation of Cp may reflect its dual roles in inflammation and iron homeostasis
11908641 Studies of the ceruloplasmin-lactoferrin complex
11783942 gene coding and flanking regions were sequenced and examined for mutations that might modulate the iron burden of individuals harboring the common mutant hemochromatosis HFE genotype or cause hemochromatosis independent of mutations in the HFE gene
11689010 difference in the molecular structure between human and bovine ceruloplasmin using SDS-PAGE and MALDI-TOF mass spectrometry
11681312 CERULOPLASMIN haS a role in iron uptake rather than release in BT325 cells.

AA Sequence

MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGPDRIGRLYKKA      1 - 70
LYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFHSHGITYYKEHEGAIYPDNTT     71 - 140
DFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYHSHIDAPKDIASGLIGPLIICKKDSLDKEKE    141 - 210
KHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDR    211 - 280
VKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQA    281 - 350
FFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY    351 - 420
KKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGVRFNKNNEGTY    421 - 490
YSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYYSAVDPTKDIFTGLIGPMKIC    491 - 560
KKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGN    561 - 630
QPGLTMCKGDSVVWYLFSAGNEADVHGIYFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECL    631 - 700
TTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDK    701 - 770
GEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ    771 - 840
TESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVCRRPYLKVFNP    841 - 910
RRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEV    911 - 980
NWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFPGTYQTLEMFPRTPGIWLLHCHVTDHIHAGM    981 - 1050
ETTYTVLQNEDTKSG                                                          1051 - 1065
//

Text Mined References (161)

PMID Year Title
26537957 2015 Ceruloplasmin functional changes in Parkinson's disease-cerebrospinal fluid.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25843655 2015 Ceruloplasmin is an endogenous protectant against kainate neurotoxicity.
25758665 2015 Single-nucleotide polymorphisms and haplotypes of non-coding area in the CP gene are correlated with Parkinson's disease.
25661792 2015 Aceruloplasminemia presents as Type 1 diabetes in non-obese adults: a detailed case series.
25595436 2015 Identification of potential pancreatic cancer serum markers: Increased sialyl-Lewis X on ceruloplasmin.
25490030 2015 PON-1 and ferroxidase activities in older patients with mild cognitive impairment, late onset Alzheimer's disease or vascular dementia.
25463281 2015 Association between maternal micronutrient status, oxidative stress, and common genetic variants in antioxidant enzymes at 15 weeks? gestation in nulliparous women who subsequently develop preeclampsia.
25398823 Serum ferroxidase activity in patients with multiple sclerosis: a pilot study.
25311416 2014 Activation of C6 glioblastoma cell ceruloplasmin expression by neighboring human brain endothelia-derived interleukins in an in vitro blood-brain barrier model system.
25265377 2014 Mercury metallation of the copper protein azurin and structural insight into possible heavy metal reactivity.
24988611 2014 [Ceruloplasmin, hephaestin and zyklopen: the three multicopper oxidases important for human iron metabolism].
24799124 2014 Mass-selected site-specific core-fucosylation of ceruloplasmin in alcohol-related hepatocellular carcinoma.
24676332 2014 Ceruloplasmin is a novel adipokine which is overexpressed in adipose tissue of obese subjects and in obesity-associated cancer cells.
24533165 2014 Glial cell ceruloplasmin and hepcidin differentially regulate iron efflux from brain microvascular endothelial cells.
24366863 2014 Oxidation-induced structural changes of ceruloplasmin foster NGR motif deamidation that promotes integrin binding and signaling.
24311705 2014 Plasma ceruloplasmin, a regulator of nitric oxide activity, and incident cardiovascular risk in patients with CKD.
24282481 2013 Serum ceruloplasmin levels correlate negatively with liver fibrosis in males with chronic hepatitis B: a new noninvasive model for predicting liver fibrosis in HBV-related liver disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256706 2014 Hypertension increases urinary excretion of immunoglobulin G, ceruloplasmin and transferrin in normoalbuminuric patients with type 2 diabetes mellitus.
24118451 2014 Ceruloplasmin and atrial fibrillation: evidence of causality from a population-based Mendelian randomization study.
24072069 2014 Meta-analysis of serum non-ceruloplasmin copper in Alzheimer's disease.
23925487 2014 Gelsolin and ceruloplasmin as potential predictive biomarkers for cervical cancer by 2D-DIGE proteomics analysis.
23861484 2013 Ceruloplasmin and heart failure in the Atherosclerosis Risk in Communities study.
23812204 2013 Effectiveness of oral iron chelator treatment with deferasirox in an aceruloplasminemia patient with a novel ceruloplasmin gene mutation.
23786280 2013 Eosinophil activation and novel mediators in the aspirin-induced nasal response in AERD.
23781119 2013 Ceruloplasmin and the extent of heart failure in ischemic and nonischemic cardiomyopathy patients.
23640881 2013 Ferroportin and exocytoplasmic ferroxidase activity are required for brain microvascular endothelial cell iron efflux.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23505556 2013 Ceruloplasmin is a potential biomarker for aGvHD following allogeneic hematopoietic stem cell transplantation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23344859 2013 Metal binding sites of human H-chain ferritin and iron transport mechanism to the ferroxidase sites: a molecular dynamics simulation study.
23306200 2013 Ceruloplasmin is an endogenous inhibitor of myeloperoxidase.
23154483 2013 Levels of serum ceruloplasmin associate with pediatric nonalcoholic fatty liver disease.
23012398 2013 Iron homeostasis in porphyria cutanea tarda: mutation analysis of promoter regions of CP, CYBRD1, HAMP and SLC40A1.
22923205 2012 The effect of occupational lead exposure on blood levels of zinc, iron, copper, selenium and related proteins.
22708402 [The investigation of alpha1-antitripsin, orozomukoid and ceruloplasmin in peripheral blood and oral fluid. Paradontitis is one of more risk factors of cardiovascular diseases].
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22075249 2012 Clinical and genetic association of serum ceruloplasmin with cardiovascular risk.
21901748 2012 Molecular analysis of ceruloplasmin in a South African cohort presenting with oesophageal cancer.
21706376 2011 Plasma ceruloplasmin ferroxidase activity correlates with the nigral sonographic area in Parkinson's disease patients: a pilot study.
21474797 2011 Label-free quantitative proteomics reveals differentially regulated proteins influencing urolithiasis.
21315066 2011 Association of haptoglobin phenotypes with ceruloplasmin ferroxidase activity in ?-thalassemia major.
21314617 2010 Interaction of ceruloplasmin and 5-lipoxygenase.
21185807 2011 FOXO1 stimulates ceruloplasmin promoter activity in human hepatoma cells treated with IL-6.
21109502 2011 Decreased serum ceruloplasmin levels characteristically aggravate nigral iron deposition in Parkinson's disease.
20801540 2010 Hepatic but not brain iron is rapidly chelated by deferasirox in aceruloplasminemia due to a novel gene mutation.
20658982 2010 Interactions of caeruloplasmin with other proteins participating in inflammation.
20655381 2010 Biological effects of mutant ceruloplasmin on hepcidin-mediated internalization of ferroportin.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19996109 2010 Identification of human plasma proteins as major clients for the extracellular chaperone clusterin.
19916937 2009 Study of interaction of ceruloplasmin, lactoferrin, and myeloperoxidase by photon correlation spectroscopy.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19821764 2010 Ferritin ferroxidase activity: a potent inhibitor of osteogenesis.
19681912 2010 Increased oxidized low density lipoprotein associated with high ceruloplasmin activity in patients with active acromegaly.
19670106 2009 Diurnal changes in urinary excretion of IgG, transferrin, and ceruloplasmin depend on diurnal changes in systemic blood pressure in normotensive, normoalbuminuric type 2 diabetic patients.
19648144 Lipid profile, low-density lipoprotein oxidation and ceruloplasmin in the progeny of families with a positive history of cardiovascular diseases and/or hyperlipidemia.
19585161 2009 Computational modeling of the dizinc-ferroxidase complex of human H ferritin: direct comparison of the density functional theory calculated and experimental structures.
19471883 2009 A novel and one-step purification of human ceruloplasmin by acharan sulfate affinity chromatography.
19382692 2009 [Regulation of ceruloplasmin gene activity in mammary gland cells].
19228837 2009 Ceruloplasmin/Transferrin system is related to clinical status in acute stroke.
19164917 Ceruloplasmin fragmentation is implicated in 'free' copper deregulation of Alzheimer's disease.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19159062 2008 Lower serum ceruloplasmin levels correlate with younger age of onset in Parkinson's disease.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19095659 2009 Dominant mutants of ceruloplasmin impair the copper loading machinery in aceruloplasminemia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19031316 2008 Ceruloplasmin and myeloperoxidase in complex affect the enzymatic properties of each other.
19019832 2009 Reactive oxygen species regulate ceruloplasmin by a novel mRNA decay mechanism involving its 3'-untranslated region: implications in neurodegenerative diseases.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18952589 2008 Hyaluronan regulates ceruloplasmin production by gliomas and their treatment-resistant multipotent progenitors.
18679377 2008 Placental expression of ceruloplasmin in pregnancies complicated by severe preeclampsia.
18388036 Ceruloplasmin is a better predictor of the long-term prognosis compared with fibrinogen, CRP, and IL-6 in patients with severe unstable angina.
18311828 2008 High brain iron level in asymptomatic carriers of heterozygous ceruloplasmin gene mutations.
18307039 2008 Free copper, ferroxidase and SOD1 activities, lipid peroxidation and NO(x) content in the CSF. A different marker profile in four neurodegenerative diseases.
18293024 2008 Multiple motor system dysfunction associated with a heterozygous ceruloplasmin gene mutation.
18200628 2008 Aceruloplasminemia: a novel mutation in a family with marked phenotypic variability.
18187043 2008 The measurement of serum ceruloplasmin is useful for diagnostic differentiation of immune thrombocytopenic purpura.
18060472 2008 Features of ceruloplasmin in the cerebrospinal fluid of Alzheimer's disease patients.
18022819 2008 Neither human hephaestin nor ceruloplasmin forms a stable complex with transferrin.
17991445 2008 Ceruloplasmin expression by human peripheral blood lymphocytes: a new link between immunity and iron metabolism.
17965133 2008 Role of copper in thermal stability of human ceruloplasmin.
17897319 2007 Integral and associated lysosomal membrane proteins.
17688883 2008 Patterns of correlation of plasma ceruloplasmin in sepsis.
17661447 2007 Discrete roles of copper ions in chemical unfolding of human ceruloplasmin.
17637479 2007 Cys-881 is essential for the trafficking and secretion of truncated mutant ceruloplasmin in aceruloplasminemia.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17597152 2007 Structural characterization of the ceruloplasmin: lactoferrin complex in solution.
17404760 2007 Neutrophil activation, protein oxidation and ceruloplasmin levels in children with Henoch-Schönlein purpura.
17242517 2007 Ceruloplasmin revisited: structural and functional roles of various metal cation-binding sites.
17032174 2007 Regulation of ceruloplasmin in human hepatic cells by redox active copper: identification of a novel AP-1 site in the ceruloplasmin gene.
17013908 2006 Novel mutation in the ceruloplasmin gene causing a cognitive and movement disorder with diabetes mellitus.
16831606 2006 Hepatic iron overload associated with a decreased serum ceruloplasmin level in a novel clinical type of aceruloplasminemia.
16775387 2006 Biochemical features of ceruloplasmin gene mutations linked to aceruloplasminemia.
16756764 2006 Oxidative modification of human ceruloplasmin by methylglyoxal: an in vitro study.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16373913 2006 Increased urinary excretions of immunoglobulin g, ceruloplasmin, and transferrin predict development of microalbuminuria in patients with type 2 diabetes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16150804 2005 Functional relevance of ceruloplasmin mutations in Parkinson's disease.
15752613 2005 The revelation of expressing region in the processed ceruloplasmin gene in human genome by biocomputational and biochemical methods.
15741220 2005 Copper-dependent activation of hypoxia-inducible factor (HIF)-1: implications for ceruloplasmin regulation.
15668644 2005 Ceruloplasmin - acute-phase reactant or endogenous antioxidant? The case of cardiovascular disease.
15648851 2004 Phenotype and allele frequencies of some serum protein polymorphisms in populations of the Balkans.
15557511 2004 Ceruloplasmin gene variations and substantia nigra hyperechogenicity in Parkinson disease.
15111541 2004 Parallel increase in urinary excretion rates of immunoglobulin G, ceruloplasmin, transferrin, and orosomucoid in normoalbuminuric type 2 diabetic patients.
15103512 2004 The relationship between haptoglobin polymorphism and serum ceruloplasmin ferroxidase activity.
15084671 2004 A proteomic analysis of human bile.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12952974 2003 Role of ceruloplasmin in macrophage iron efflux during hypoxia.
12724641 2003 Increased expression of ceruloplasmin in the retina following photic injury.
12708132 2003 Copper and ceruloplasmin status in serum of prostate and colon cancer patients.
12575997 2003 Translational control by the 3'-UTR: the ends specify the means.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351628 2002 Mechanisms of copper incorporation into human ceruloplasmin.
12177070 2002 A key structural role for active site type 3 copper ions in human ceruloplasmin.
12175089 2002 Levels of antioxidant proteins and soluble intercellular adhesion molecule-1 in serum of patients with rheumatoid arthritis.
12132593 2002 Carnosine and related dipeptides protect human ceruloplasmin against peroxyl radical-mediated modification.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
12055353 2002 Ceruloplasmin metabolism and function.
12029093 2002 Dual role of insulin in transcriptional regulation of the acute phase reactant ceruloplasmin.
11908641 2002 Studies of the ceruloplasmin-lactoferrin complex.
11783942 A study of genes that may modulate the expression of hereditary hemochromatosis: transferrin receptor-1, ferroportin, ceruloplasmin, ferritin light and heavy chains, iron regulatory proteins (IRP)-1 and -2, and hepcidin.
11095930 2000 The effect of ceruloplasmin on iron release from placental (BeWo) cells; evidence for an endogenous Cu oxidase.
11040994 2000 [Identification of a fragment of ceruloplasmin, interacting with copper-transporting Menkes ATPase].
10666301 2000 Interaction of lactoferrin with ceruloplasmin.
10660599 2000 Alternative RNA splicing generates a glycosylphosphatidylinositol-anchored form of ceruloplasmin in mammalian brain.
10490627 1999 Delayed translational silencing of ceruloplasmin transcript in gamma interferon-activated U937 monocytic cells: role of the 3' untranslated region.
9788274 1998 Ran-2, a glial lineage marker, is a GPI-anchored form of ceruloplasmin.
9727700 1998 Aceruloplasminemia.
9500710 1998 Intracellular distribution of the Wilson's disease gene product (ATPase7B) after in vitro and in vivo exogenous expression in hepatocytes from the LEC rat, an animal model of Wilson's disease.
9445478 1998 Role of ceruloplasmin in cellular iron uptake.
9360306 1997 Comparative analysis of the molecular heterogeneity of ceruloplasmin from human blood and breast milk.
9097926 1997 Binding and inhibition of myeloperoxidase (MPO): a major function of ceruloplasmin?
8968753 1996 Expression of the ceruloplasmin gene in the human retina and brain: implications for a pathogenic model in aceruloplasminemia.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8789443 1996 Characterization of a nonsense mutation in the ceruloplasmin gene resulting in diabetes and neurodegenerative disease.
8679709 1996 Expression of ceruloplasmin gene in human and rat lymphocytes.
7708681 1995 Aceruloplasminemia: molecular characterization of this disorder of iron metabolism.
7702601 1995 Fine structure of the human ceruloplasmin gene.
6987230 1980 Primary structure of a histidine-rich proteolytic fragment of human ceruloplasmin. II. Amino acid sequence of the tryptic peptides.
6987229 1980 Primary structure of a histidine-rich proteolytic fragment of human ceruloplasmin. I. Amino acid sequence of the cyanogen bromide peptides.
6940148 1981 Complete amino acid sequence of a 50,000-dalton fragment of human ceruloplasmin.
6582496 1984 Single-chain structure of human ceruloplasmin: the complete amino acid sequence of the whole molecule.
6571985 1983 Internal triplication in the structure of human ceruloplasmin.
6479854 Origins of biliary copper.
6337857 1983 Subcellular localization in normal and vitamin A-deficient rat liver of vitamin A serum transport proteins, albumin, ceruloplasmin and class I major histocompatibility antigens.
3755405 1986 Isolation of a human ceruloplasmin cDNA clone that includes the N-terminal leader sequence.
3486416 1986 Characterization, mapping, and expression of the human ceruloplasmin gene.
3474786 1987 Human genes encoding prothrombin and ceruloplasmin map to 11p11-q12 and 3q21-24, respectively.
2873574 1986 Complete cDNA sequence of human preceruloplasmin.
2355023 1990 Human ceruloplasmin. Tissue-specific expression of transcripts produced by alternative splicing.
2332446 1990 Primary structure of rat ceruloplasmin and analysis of tissue-specific gene expression during development.
2154449 1990 Detection of multiple forms of human ceruloplasmin. A novel Mr 200,000 form.
2105310 1990 Characterization of an interaction between protein C and ceruloplasmin.
1463466 1992 Caeruloplasmin biosynthesis by the human uterus.
463490 1979 Interaction of synthetic human big gastrin with blood proteins of man and animals.
146197 1977 Chemical evidence that proteolytic cleavage causes the heterogeneity present in human ceruloplasmin preparations.