Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.69
PubTator Score 3.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.400 2.0e-02
psoriasis -1.100 6.4e-04
glioblastoma -2.000 6.0e-04
oligodendroglioma -1.100 5.1e-10
osteosarcoma -2.298 9.0e-06
atypical teratoid / rhabdoid tumor -2.100 5.2e-04
medulloblastoma, large-cell -2.200 1.0e-04
hereditary spastic paraplegia -1.140 4.2e-03
pancreatic ductal adenocarcinoma liver m... -1.171 3.5e-02
intraductal papillary-mucinous carcinoma... 1.100 1.8e-03
intraductal papillary-mucinous neoplasm ... 1.500 7.4e-04
pediatric high grade glioma -1.600 4.1e-04
Polycystic Ovary Syndrome 1.053 6.5e-03
Pick disease -1.400 1.4e-03
ulcerative colitis -1.100 2.7e-03
Breast cancer 1.200 4.6e-07
pituitary cancer 1.100 2.1e-05

 MGI Phenotype (1)

Gene RIF (4)

PMID Text
23122588 study analyzed the X-linked COX7B and found deleterious de novo mutations in two simplex cases of microphthalmia with linear skin lesions and a nonsense mutation, which segregates with the disease, in a familial case
22860893 Data indicate that recombinant (r)IL-24 stimulated the mitochondrial apoptotic pathway genes Bax, Bid, Casp8, COX6C, COX7B after 36 h.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20307258 Novel insights into the assembly and function of human nuclear-encoded cytochrome c oxidase subunits 7b

AA Sequence

MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVG      1 - 70
RVTPKEWRNQ                                                                 71 - 80
//

Text Mined References (13)

PMID Year Title
23122588 2012 Mutations in COX7B cause microphthalmia with linear skin lesions, an unconventional mitochondrial disease.
22860893 2013 Interleukin-24 mediates apoptosis in human B-cells through early activation of cell cycle arrest followed by late induction of the mitochondrial apoptosis pathway.
20307258 2010 Novel insights into the assembly and function of human nuclear-encoded cytochrome c oxidase subunits 4, 5a, 6a, 7a and 7b.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9752724 1998 Structural organization and transcription regulation of nuclear genes encoding the mammalian cytochrome c oxidase complex.
9660196 1998 Assembly of cytochrome-c oxidase in cultured human cells.
8781533 1996 Biochemical analysis of fibroblasts from patients with cytochrome c oxidase-associated Leigh syndrome.
8382530 1993 Isolation of a cDNA specifying subunit VIIb of human cytochrome c oxidase.
3007143 1986 Tissue-specific and species-specific distribution of -SH groups in cytochrome c oxidase subunits.
1309697 1992 Subunits VIIa,b,c of human cytochrome c oxidase. Identification of both 'heart-type' and 'liver-type' isoforms of subunit VIIa in human heart.