Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.08
PubTator Score 9.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 2.4e-04
lung cancer 4740 5.2e-04
Multiple myeloma 1332 2.1e-03
Breast cancer 3578 2.6e-02
Waldenstrons macroglobulinemia 765 2.6e-02
Disease Target Count Z-score Confidence
Kidney hypertrophy 4 3.161 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 3.200 2.6e-02
breast carcinoma 1.900 2.4e-04
lung cancer 1.500 5.2e-04
Multiple myeloma 1.349 2.1e-03
Waldenstrons macroglobulinemia 1.071 2.6e-02

Gene RIF (6)

AA Sequence

MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI      1 - 70
FQSVK                                                                      71 - 75
//

Text Mined References (18)

PMID Year Title