Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.39
PubTator Score 9.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1614 2.4e-04
lung cancer 4473 5.2e-04
Multiple myeloma 1327 2.1e-03
Breast cancer 3098 2.6e-02
Waldenstrons macroglobulinemia 764 2.6e-02
Disease Target Count Z-score Confidence
Kidney hypertrophy 4 3.165 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.071 2.6e-02
Multiple myeloma 1.349 2.1e-03
lung cancer 1.500 5.2e-04
breast carcinoma 1.900 2.4e-04
Breast cancer 3.200 2.6e-02

Gene RIF (6)

PMID Text
25203353 Within the first 3h of infection with influenza virus, significant down-regulation of hsa-miRNA-4276 is followed by a 2-fold increase in cytochrome c oxidase VIc mRNA was found to occur in human alveolar and bronchial epithelial cells.
22860893 Data indicate that recombinant (r)IL-24 stimulated the mitochondrial apoptotic pathway genes Bax, Bid, Casp8, COX6C, COX7B after 36 h.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20877624 Observational study of gene-disease association. (HuGE Navigator)
19843159 Data found that subunits Cox6a, Cox6b and Cox7a assembled into pre-existing complex IV, while Cox4-1 and Cox6c subunits assembled into subcomplexes that may represent rate-limiting intermediates.
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI      1 - 70
FQSVK                                                                      71 - 75
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25203353 2014 Lung epithelial cells resist influenza A infection by inducing the expression of cytochrome c oxidase VIc which is modulated by miRNA 4276.
22860893 2013 Interleukin-24 mediates apoptosis in human B-cells through early activation of cell cycle arrest followed by late induction of the mitochondrial apoptosis pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19843159 2009 Assembly of nuclear DNA-encoded subunits into mitochondrial complex IV, and their preferential integration into supercomplex forms in patient mitochondria.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17516841 2007 Mid-region parathyroid hormone-related protein (PTHrP) and gene expression of MDA-MB231 breast cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10072584 1998 Assignment of the human genes coding for cytochrome c oxidase subunits Va (COX5A), VIc (COX6C) and VIIc (COX7C) to chromosome bands 15q25, 8q22-->q23 and 5q14 and of three pseudogenes (COX5AP1, COX6CP1, COX7CP1) to 14q22, 16p12 and 13q14-->q21 by FISH and radiation hybrid mapping.
9930743 1999 Decreased brain protein levels of cytochrome oxidase subunits in Alzheimer's disease and in hereditary spinocerebellar ataxia disorders: a nonspecific change?
9752724 1998 Structural organization and transcription regulation of nuclear genes encoding the mammalian cytochrome c oxidase complex.
8705997 1996 Two differentially expressed genes in normal human prostate tissue and in carcinoma.
2849755 1988 Nucleotide sequence of cDNA encoding human cytochrome c oxidase subunit VIc.