Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.28
PubTator Score 3.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1158 2.5e-06
dermatomyositis 966 4.2e-03

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy -1.021 2.5e-06
dermatomyositis -1.400 4.2e-03

Gene RIF (1)

AA Sequence

MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTK      1 - 70
PYPWGDGNHTLFHNSHVNPLPTGYEHP                                                71 - 97
//

Text Mined References (8)

PMID Year Title