Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.72
PubTator Score 3.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1157 2.5e-06
dermatomyositis 966 4.2e-03

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy -1.021 2.5e-06
dermatomyositis -1.400 4.2e-03

Synonym

Accession Q02221 O00761 Q6GTW6
Symbols COX6AH
COXVIAH

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples

AA Sequence

MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTK      1 - 70
PYPWGDGNHTLFHNSHVNPLPTGYEHP                                                71 - 97
//

Text Mined References (8)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9284905 1997 Assignment of COX6A1 to 6p21 and a pseudogene (COX6A1P) to 1p31.1 by in situ hybridization and somatic cell hybrids.
9177785 1997 Structure of the human gene (COX6A2) for the heart/muscle isoform of cytochrome c oxidase subunit VIa and its chromosomal location in humans, mice, and cattle.
8681137 1996 Identification of 4370 expressed sequence tags from a 3'-end-specific cDNA library of human skeletal muscle by DNA sequencing and filter hybridization.
8241294 1993 Tissue distribution of cytochrome c oxidase isoforms in mammals. Characterization with monoclonal and polyclonal antibodies.
1327966 1992 Differential expression of genes specifying two isoforms of subunit VIa of human cytochrome c oxidase.