Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.34
PubTator Score 10.46

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPE      1 - 70
FIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE                                    71 - 109
//

Text Mined References (20)

PMID Year Title