Property Summary

NCBI Gene PubMed Count 21
PubMed Score 29.23
PubTator Score 11.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.105 1.7e-04
pancreatic ductal adenocarcinoma liver m... -1.435 8.6e-03
non primary Sjogren syndrome sicca 1.200 4.7e-02
ulcerative colitis -1.200 3.9e-06
ovarian cancer 1.500 3.5e-04

Gene RIF (7)

PMID Text
26506233 silence of COX5B leads to metabolic disorders, such as increased glucose uptake and decreased lactate secretion
22917272 Transfected the A549 cells with COX Vb small interfering or shRNA and observed a significant reduction of their COX activity, oxygen consumption, ATP and ability to grow in soft agar and as poorly differentiated tumors in athymic mice.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
20877624 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19834492 Data show that Bcl-2 expression positively influences the targeting of nuclear-encoded COX Va and Vb to the mitochondria of cancer cells.

AA Sequence

MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGA      1 - 70
SGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH                71 - 129
//

Text Mined References (25)

PMID Year Title
26506233 2015 Loss of COX5B inhibits proliferation and promotes senescence via mitochondrial dysfunction in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22917272 2012 Cytochrome c oxidase is activated by the oncoprotein Ras and is required for A549 lung adenocarcinoma growth.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19834492 2010 Involvement of cytochrome c oxidase subunits Va and Vb in the regulation of cancer cell metabolism by Bcl-2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11719263 Cytochrome c oxidase subunit Vb interacts with human androgen receptor: a potential mechanism for neurotoxicity in spinobulbar muscular atrophy.
10915781 2000 Autocrine gastrins in colon cancer cells Up-regulate cytochrome c oxidase Vb and down-regulate efflux of cytochrome c and activation of caspase-3.
9030264 1997 Quantitative decrease of human cytochrome c oxidase during development: evidences for a post-transcriptional regulation.
8806766 1996 Phylogenetic footprinting of the human cytochrome c oxidase subunit VB promoter.
8313870 1993 Human liver protein map: update 1993.
2840351 1988 Sequence of cDNAs encoding subunit Vb of human and bovine cytochrome c oxidase.
2162812 1990 Immunohistochemical demonstration of fibre type-specific isozymes of cytochrome c oxidase in human skeletal muscle.
1646156 1991 Structure of the human cytochrome c oxidase subunit Vb gene and chromosomal mapping of the coding gene and of seven pseudogenes.