Property Summary

NCBI Gene PubMed Count 19
PubMed Score 43.25
PubTator Score 8.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.100 3.9e-08
non-small cell lung cancer -1.877 7.7e-30

Gene RIF (6)

AA Sequence

MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKG      1 - 70
SWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERK     71 - 140
AQQLQRMLDMKVNPVQGLASRWDYEKKQWKK                                           141 - 171
//

Text Mined References (19)

PMID Year Title