Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.30
PubTator Score 4.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.5e-04
osteosarcoma 7950 1.9e-03
Disease Target Count Z-score Confidence
Menkes disease 19 3.62 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.502 1.9e-03
ovarian cancer -1.100 1.5e-04

Synonym

Accession Q49B96 A4FTX0 hCOX19
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ      1 - 70
EPLEKLGFGDLTSGKSEAKK                                                       71 - 90
//

Text Mined References (12)

PMID Year Title