Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.14
PubTator Score 4.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.5e-04
osteosarcoma 7933 1.9e-03
Disease Target Count Z-score Confidence
Menkes disease 20 3.612 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.502 1.9e-03
ovarian cancer -1.100 1.5e-04

Synonym

Accession Q49B96 A4FTX0 hCOX19
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Protein-protein Interaction (2)

Gene RIF (2)

PMID Text
23345593 COX19 is necessary for the transduction of a SCO1-dependent mitochondrial redox signal that regulates ATP7A-mediated cellular copper efflux.
16212937 Both hCox18p and hCox19p present significant amino acid identity with the corresponding yeast polypeptides and reveal highly conserved functional domains.

AA Sequence

MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ      1 - 70
EPLEKLGFGDLTSGKSEAKK                                                       71 - 90
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23345593 2013 COX19 mediates the transduction of a mitochondrial redox signal from SCO1 that regulates ATP7A-mediated cellular copper efflux.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16212937 2005 hCOX18 and hCOX19: two human genes involved in cytochrome c oxidase assembly.
15596615 2004 Studies of COX16, COX19, and PET191 in human cytochrome-c oxidase deficiency.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.