Property Summary

NCBI Gene PubMed Count 27
PubMed Score 39.72
PubTator Score 37.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26745464 In addition to Atox1, the human cytoplasm also contains Cu chaperones for loading of superoxide dismutase 1 (i.e. CCS) and cytochrome c oxidase in mitochondria (i.e. Cox17). [review]
26589182 Data show that the redox state of cytochrome c oxidase assembly protein 17 (Cox17), mitochondrial membrane transport protein Mia40 and superoxide dismutase 1 (SOD1) in the cytoplasm were directly observed with in-cell NMR spectroscopy.
26399480 Data suggest that Cox17 enhances the reactivity of some platinum/organoplatinum antineoplastic drugs but suppresses the reactivity of at least one platinum antineoplastic drug; glutathione modulates binding of platinum/organoplatinum drugs to Cox17.
24343031 CTR1 silencing increased the protein levels of copper chaperone ATOX1 and copper chaperone for superoxide dismutase 1 (CCS-1), but decreased copper chaperone for cytochrome c oxidase (COX17).
21816817 Functional role of two interhelical disulfide bonds in human Cox17 protein from a structural perspective.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19393246 the absence of Cox17 interferes with copper delivery to Cox2, but not to Cox1.
18458339 Cu(I)HCox17(2S-S), i.e., the copper-loaded form of the protein, can transfer simultaneously copper(I) and two electrons to the human cochaperone Sco1 (HSco1) in the oxidized state, i.e., with its metal-binding cysteines forming a disulfide bond.
17672825 XAS (X-ray absorption spectroscopy) determined that Cu4Cox17 contains a Cu4S6-type copper-thiolate cluster, which may provide safe storage of an excess of copper ions
17208454 Cox17 was studied with regard to its expression, purification, and formation of mixed disulfide adducts with sulfhydryl reagents.
16520371 Cox17-mediated copper metallation of Sco1, as well as the subsequent failure of Cu(A) site maturation, is the basis for the inefficient assembly of the cytochrome c oxidase complex in SCO1 patients
15504366 The binding of copper to Cox17 is needed to activate cytochrome c oxidase by Cox17.
14612491 Data imply that up-regulation of COX17 function and increased cytochrome c oxidase activity are frequent features of lung carcinogenesis.

AA Sequence

MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI             1 - 63
//

Text Mined References (34)

PMID Year Title
26745464 2016 Extended functional repertoire for human copper chaperones.
26589182 2016 Direct structural evidence of protein redox regulation obtained by in-cell NMR.
26399480 2015 Glutathione selectively modulates the binding of platinum drugs to human copper chaperone Cox17.
25416956 2014 A proteome-scale map of the human interactome network.
24343031 2014 Changes in copper concentrations affect the protein levels but not the mRNA levels of copper chaperones in human umbilical vein endothelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22356826 2012 Iterative orthology prediction uncovers new mitochondrial proteins and identifies C12orf62 as the human ortholog of COX14, a protein involved in the assembly of cytochrome c oxidase.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21816817 2011 Functional role of two interhelical disulfide bonds in human Cox17 protein from a structural perspective.
21269460 2011 Initial characterization of the human central proteome.
21059946 2010 Molecular chaperone function of Mia40 triggers consecutive induced folding steps of the substrate in mitochondrial protein import.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19393246 2009 Knockdown of human COX17 affects assembly and supramolecular organization of cytochrome c oxidase.
18458339 2008 Mitochondrial copper(I) transfer from Cox17 to Sco1 is coupled to electron transfer.
18093982 2008 A structural-dynamical characterization of human Cox17.
17672825 2007 Oxidative switches in functioning of mammalian copper chaperone Cox17.
17208454 2007 Cox17, a copper chaperone for cytochrome c oxidase: expression, purification, and formation of mixed disulphide adducts with thiol reagents.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16520371 2006 The P174L mutation in human Sco1 severely compromises Cox17-dependent metallation but does not impair copper binding.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15893662 2005 Folding studies of Cox17 reveal an important interplay of cysteine oxidation and copper binding.
15504366 2004 A selective requirement for copper-dependent activation of cytochrome c oxidase by Cox17p.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612491 2003 Identification of COX17 as a therapeutic target for non-small cell lung cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11170391 2001 The mitochondrial copper metallochaperone Cox17 exists as an oligomeric, polycopper complex.
11054125 2000 The expression of Cox17p in rodent tissues and cells.
11027508 2000 Characterization of human SCO1 and COX17 genes in mitochondrial cytochrome-c-oxidase deficiency.
10982038 2000 Characterization and localization of human COX17, a gene involved in mitochondrial copper transport.
9050918 1997 Isolation of a cDNA encoding the human homolog of COX17, a yeast gene essential for mitochondrial copper recruitment.