Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.20
PubTator Score 3.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 2.1e-02
diabetes mellitus -1.100 9.2e-03
ependymoma -1.200 2.5e-02
pancreatic ductal adenocarcinoma liver m... -1.776 7.7e-03

Gene RIF (3)

AA Sequence

MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM                   1 - 57
//

Text Mined References (13)

PMID Year Title