Property Summary

NCBI Gene PubMed Count 29
PubMed Score 17.27
PubTator Score 65.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Disease log2 FC p
Barrett's esophagus 2.100 1.5e-02
esophageal adenocarcinoma 2.300 1.8e-02
cutaneous lupus erythematosus 1.700 4.1e-03
glioblastoma 2.400 2.0e-05
osteosarcoma -2.268 7.2e-04
posterior fossa group A ependymoma 1.700 1.4e-10
astrocytoma 2.300 7.2e-03
atypical teratoid / rhabdoid tumor 2.000 1.8e-06
medulloblastoma, large-cell 2.100 6.1e-04
primitive neuroectodermal tumor 1.400 1.9e-02
Duchenne muscular dystrophy 1.291 2.0e-10
limb girdle muscular dystrophy 2I 1.050 1.5e-03
Becker muscular dystrophy 1.125 4.1e-04
juvenile dermatomyositis 1.447 7.5e-06
Atopic dermatitis 1.200 9.2e-03
primary pancreatic ductal adenocarcinoma 2.353 4.7e-05
tuberculosis and treatment for 6 months 1.900 2.5e-03
non-small cell lung cancer -1.178 1.6e-11
intraductal papillary-mucinous neoplasm ... 1.900 2.6e-02
lung cancer -2.100 6.7e-05
pancreatic cancer 2.200 2.5e-04
interstitial cystitis 2.000 6.9e-04
pediatric high grade glioma 1.900 5.8e-08
pilocytic astrocytoma 2.300 6.8e-11
primary Sjogren syndrome 2.600 2.1e-04
subependymal giant cell astrocytoma 1.339 1.1e-02
psoriasis 1.300 2.9e-09
Breast cancer 1.500 3.2e-03
spina bifida 1.347 5.0e-02
ulcerative colitis 1.500 1.9e-05
ovarian cancer -2.500 1.7e-07
pituitary cancer -1.100 3.1e-03

Gene RIF (14)

PMID Text
25034252 The roles of CLP and FLAP in in cellular leukotriene biosynthesis, were studied.
24454796 COTL1 regulates lamellipodia dynamics in part by protecting F-actin from cofilin-mediated disassembly.
22373659 PAI-RBP1 and C1orf142 expression levels are higher in 95D (high metastatic potential) than in 95C (low metastatic potential) non-small lung cancer cells, whereas COTL1 expression level is lower in 95D when compared to 95C cells.
21047053 Up-regulated COTL-1 expression in small cell lung cancer was validated by Western blot analysis, immunohistochemistry, and qRT-qPCR.
19807693 Results of the present study support a role for CLP as a chaperoning scaffold factor, influencing both the stability and the activity of 5-LO.
19307756 We found that coactosin-like1 (COTL1) were highly expressed in rheumatoid arthritis patients compared with healthy controls
19307756 Observational study of gene-disease association. (HuGE Navigator)
17070122 extended region of beta4-beta5 of hCLP (residue 66-75) was found very flexible and very important for F-actin binding. The C-terminal residues of human coactosin-like protein were not involved in F-actin binding
16924104 Coactosin-like protein (CLP) up-regulates Ca(2+)-induced 5-lipoxygenase (5LO) activity, and increases the amount of Leukotriene A(4) formed by 5LO.
15583396 preliminary crystallographic studies of human coactosin-like protein (CLP)
15459340 structural analysis shows that CLP forms a polymer along the crystallographic b axis with the exact same repeat distance as F-actin; a model for the CLP polymer and F-actin binding has therefore been proposed.
15333945 coactosin-like protein (CLP) is an actin-binding protein as well as a 5-lipoxygenase binding partner
15213466 NMR resonance assignments and the secondary structures of human Coactosin like protein (hCLP) D123N
11870627 CLP 57-65 peptide elicits immediate-type hypersensitivity. Identical peptides are recognized by cellular and humoral immune systems to a tumor-associated antigen. CLP 15-24 and 104-113 might be used for peptide-based immunotherapy of HLA-A2(+) cancers.

AA Sequence

MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAM      1 - 70
SKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQ     71 - 140
TE                                                                        141 - 142
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25034252 2014 Roles of coactosin-like protein (CLP) and 5-lipoxygenase-activating protein (FLAP) in cellular leukotriene biosynthesis.
24454796 2014 Coactosin-like 1 antagonizes cofilin to promote lamellipodial protrusion at the immune synapse.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22373659 2012 Differential expression of PAI-RBP1, C1orf142, and COTL1 in non-small cell lung cancer cell lines with different tumor metastatic potential.
21269460 2011 Initial characterization of the human central proteome.
21047053 2011 Proteomic analysis of human small cell lung cancer tissues: up-regulation of coactosin-like protein-1.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19807693 2009 Coactosin-like protein functions as a stabilizing chaperone for 5-lipoxygenase: role of tryptophan 102.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19307756 2009 Polymorphisms of COTL1 gene identified by proteomic approach and their association with autoimmune disorders.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17070122 2006 Binding model of human coactosin-like protein with filament actin revealed by mutagenesis.
16924104 2006 Coactosin-like protein supports 5-lipoxygenase enzyme activity and up-regulates leukotriene A4 production.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15754059 2004 NMR structure of human coactosin-like protein.
15583396 2004 Crystallization and preliminary crystallographic studies of human coactosin-like protein (CLP).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459340 2004 Crystal structure of human coactosin-like protein at 1.9 A resolution.
15333945 2004 Expression, purification and preliminary crystallographic studies of human coactosin-like protein.
15213466 2004 1H, 13C and 15N resonance assignments and the secondary structures of human coactosin like protein (hCLP) D123N.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11583571 2001 Coactosin-like protein, a human F-actin-binding protein: critical role of lysine-75.
11297527 2001 5-Lipoxygenase interacts with coactosin-like protein.
10051563 1999 Interaction of 5-lipoxygenase with cellular proteins.
9326934 1997 Homologous recombination of a flanking repeat gene cluster is a mechanism for a common contiguous gene deletion syndrome.
7690594 1993 cDNA clones contain autonomous replication activity.