Property Summary

NCBI Gene PubMed Count 23
PubMed Score 1216.02
PubTator Score 323.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (14)

AA Sequence

MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEA      1 - 70
REVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK                                        71 - 105
//

Text Mined References (25)

PMID Year Title