Property Summary

NCBI Gene PubMed Count 29
PubMed Score 23.45
PubTator Score 21.99

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (13)

PMID Text
25862165 Coro1C mediated Rac1 trafficking through actin-rich vesicles.
25518741 Data indicate that coronin 1C protein (CORO1C) was a direct target of the microRNA miR-1/133a cluster in EBC-1 CORO1C was a direct target of the miR-1/133a cluster in lung-squamous cell carcinoma cell line EBC-1.
23292607 Coronin-1C overexpression is associated withand hepatocellular carcinoma growth through enhancement of tumor cell proliferation and migration, which are correlated with Rac-1 activation.
22974233 Coronin 3 promotes gastric cancer metastasis via the up-regulation of MMP-9 and cathepsin K.
20690162 There is a strong expression of both SELPLG and coronin-1C in the majority of primary effusion lymphomas, irrespective of their gene dosage. SELPLG is critical for cell migration and chemotaxis, while CORO1C regulates actin-dependent processes.
20678442 Patients with higher coronin-1C expression had a more advanced stage of hepatocellular carcinoma.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913511 Coronin 1C negatively regulates epithelial cell migration via FAK-mediated inhibition of cell-matrix adhesion.
19651142 Fndings postulate a role for CRN2 isoforms in the structural and functional organization of F-actin in highly ordered protein complexes.
19423540 Observational study of gene-disease association. (HuGE Navigator)
17274980 We show that coronin 3 similar to other coronins interacts with the Arp2/3-complex and cofilin indicating that this family in general is involved in regulating Arp2/3-mediated events.
12377779 oligomerization, F-actin interaction and membrane association are mediated by carboxyl terminus

AA Sequence

MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRID      1 - 70
KSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHP     71 - 140
TARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVA    141 - 210
EKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSII    211 - 280
YLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTV    281 - 350
PRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKC    351 - 420
DLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA                    421 - 474
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25862165 2015 Integration of the Rac1- and actin-binding properties of Coronin-1C.
25518741 2015 Downregulation of the microRNA-1/133a cluster enhances cancer cell migration and invasion in lung-squamous cell carcinoma via regulation of Coronin1C.
25074804 2014 Coronin-1C and RCC2 guide mesenchymal migration by trafficking Rac1 and controlling GEF exposure.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23292607 2013 Knockdown of Coronin-1C disrupts Rac1 activation and impairs tumorigenic potential in hepatocellular carcinoma cells.
22974233 2012 Coronin 3 promotes gastric cancer metastasis via the up-regulation of MMP-9 and cathepsin K.
22364218 2012 Coronin 1C harbours a second actin-binding site that confers co-operative binding to F-actin.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20690162 2010 Primary effusion lymphoma: genomic profiling revealed amplification of SELPLG and CORO1C encoding for proteins important for cell migration.
20678442 2010 [Increased coronin-1C expression is related to hepatocellular carcinoma invasion and metastasis].
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19913511 2010 Coronin 1C negatively regulates cell-matrix adhesion and motility of intestinal epithelial cells.
19651142 2009 Structural and functional diversity of novel coronin 1C (CRN2) isoforms in muscle.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17274980 2007 Coronin 3 involvement in F-actin-dependent processes at the cell cortex.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12377779 2002 Oligomerization, F-actin interaction, and membrane association of the ubiquitous mammalian coronin 3 are mediated by its carboxyl terminus.
10828594 2000 Isolation and chromosomal assignment of a novel human gene, CORO1C, homologous to coronin-like actin-binding proteins.
10461187 1999 The coronin family of actin-associated proteins.
9778037 1998 Definition of family of coronin-related proteins conserved between humans and mice: close genetic linkage between coronin-2 and CD45-associated protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8175911 1994 Identification of serum-inducible genes: different patterns of gene regulation during G0-->S and G1-->S progression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.