Property Summary

NCBI Gene PubMed Count 49
PubMed Score 140.22
PubTator Score 87.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.243 3.0e-03
atypical teratoid / rhabdoid tumor -2.100 2.1e-06
cutaneous lupus erythematosus 1.800 1.5e-03
ependymoma -1.400 9.1e-03
glioblastoma 1.400 2.3e-03
group 3 medulloblastoma -1.600 1.8e-02
Hydrolethalus syndrome -1.007 4.6e-02
interstitial cystitis 2.200 1.7e-03
invasive ductal carcinoma 1.424 5.7e-04
lung cancer -1.200 5.1e-04
lung carcinoma -1.600 7.0e-20
medulloblastoma, large-cell -3.000 2.0e-06
Multiple myeloma 1.332 2.4e-02
oligodendroglioma -1.300 9.3e-03
osteosarcoma -3.670 8.2e-05
ovarian cancer 1.400 4.4e-03
periodontitis 1.100 5.3e-23
primary Sjogren syndrome 1.200 1.7e-02
primitive neuroectodermal tumor -1.300 1.7e-03
psoriasis 1.100 5.5e-06
spina bifida 1.376 3.7e-02
ulcerative colitis 1.180 4.7e-02

Gene RIF (25)

AA Sequence

MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRV      1 - 70
DKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWH     71 - 140
TTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTV    141 - 210
VAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTN    211 - 280
IVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAM    281 - 350
TVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPE    351 - 420
ASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK                                 421 - 461
//

Text Mined References (56)

PMID Year Title