Property Summary

NCBI Gene PubMed Count 47
PubMed Score 129.63
PubTator Score 129.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.500 1.1e-07
cutaneous lupus erythematosus -1.600 3.0e-02
Atopic dermatitis -3.000 7.5e-04
pancreatic cancer 1.400 1.7e-03
interstitial cystitis -2.600 9.5e-04
Breast cancer 2.100 1.3e-02
pituitary cancer -1.600 2.5e-03
non-small cell lung cancer and chronic o... -1.700 3.7e-02

Gene RIF (44)

PMID Text
26577631 serum levels of corin are significantly decreased in acute myocardial infarction patients
26488448 Data show that both furin and brain type natriuretic peptide (BNP) were more sensitive than corin in predicting cardiovascular complications in type 2 diabetes mellitus (T2DM) patients.
26344336 Serum soluble corin was significantly and positively associated with dyslipidemia
26259032 identified a PCSK6 mutation that impaired corin activation activity in a hypertensive patient
26086065 Increased serum soluble corin in mid pregnancy was associated with an increased risk for HDP(hypertensive disorders of pregnancy) .--increased serum soluble corin in mid pregnancy could be an indicator for HDP
26048191 corin may play an important role in the pathology of atrial fibrillation
26022632 Serum soluble corin was decreased in patients with stroke compared with healthy controls.
25981578 Circulating corin concentrations are related to infarct size in patients after ST-segment elevation myocardial infarction
25663063 Hypertensive participants had an increased serum corin level compared to those without hypertension, suggesting that corin may play a role in the pathology of hypertension.
25649697 Plasma corin levels decreased significantly from preoperative concentrations after coronary artery bypass graft surgery.
25516437 IRE1-dependent corin mRNA decay is a mechanism leading to corin protein deficiency may contribute to the pathophysiology of impaired natriuretic peptide pro-hormone processing in humans processing in humans with advanced systolic heart failure.
25488193 the variant altered corin structure and impaired the natriuretic peptide processing activity in vivo. The results highlight corin defects as an important underlying mechanism in hypertension.
25474356 In conclusion, this is the first report of a highly significant association between these two single nucleotide polymorphisms in CORIN gene and preeclampsia.
25451932 N-glycans at different sites may play distinct roles in regulating the cell membrane targeting, zymogen activation, and ectodomain shedding of corin
24828501 data provide important insights into the molecular basis underlying corin mutations that may contribute to preeclampsia in patients.
24100222 Corin mediates an essential step in the cascade of natriuretic peptide biosynthesis and eventually their action. Thus, it is postulated that aberrations in the normal activity of corin may contribute to cardiovascular and renal diseases.
24015598 The processing of proBNP1_108 by corin may be controlled by O-linked glycosylation of proBNP1-108. A potential impairment of proBNP1lo8 processing in heart failure may be linked to dysregulation of the convertase corin.[Review]
23434834 CORIN is expressed in non-pregnant late secretory phase endometrium, first trimester human implantation sites and is up-regulated with decidualization ex vivo
23372161 human CORIN gene mutations causing impaired corin activity may be an underlying mechanism in hypertension
23327554 The results indicate that renal tubular corin may be shed into urine and that urinary and renal corin levels were reduced in chronic kidney disease patients.
22987923 Results indicate that corin defects may represent an important mechanism in salt-sensitive hypertension and cardiac hypertrophy in blacks.
22437503 results indicate that corin and ANP are essential for physiological changes at the maternal-fetal interface, suggesting that defects in corin and ANP function may contribute to pre-eclampsia
22093942 the function and regulation of corin
21518754 the sequence in the cytoplasmic tail plays an important role in corin cell surface targeting and zymogen activation.
21288900 Ectodomain shedding and autocleavage of the cardiac membrane protease corin.
21216831 Data suggest that there may be patients for whom low corin levels and impaired pro-ANP cleavage contribute to acute decompensated heart failure.
20802129 Insufficient corin activation is expected to prevent natriuretic peptide processing and may contribute to body fluid retention and impaired cardiac function in patients with heart failure.
20670840 A modest correlation is demonstrated between plasma corin levels and individual echocardiographic indices of cardiac hypertrophy, but no relationships between plasma corin and myocardial performance are proved in this study.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20613715 corin might be involved in the salt retention seen in glomerular diseases.
19919978 Dysfunctional corin i555(p568) allele is associated with impaired brain natriuretic peptide processing and adverse outcomes in blacks with systolic heart failure: results from the Genetic Risk Assessment in Heart Failure substudy.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of corin, serine peptidase (CORIN) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19326473 Observational study of gene-disease association. (HuGE Navigator)
18669922 corin gene single nucleotide polymorphism associated with hypertension and cardiac hypertrophy impair corin zymogen activation and natriuretic peptide processing activity
17890485 ANP and corin are expressed at the mRNA level in human adipose tissue and preadipocytes
17660514 N-linked oligosaccharides play an important role in corin activation
17296875 Corin I555(P568) allele represents a cardiac hypertrophy-sensitizing genetic locus in systemic hypertension.
16216958 Observational study of gene-disease association. (HuGE Navigator)
16216958 The corin I555 (P568) allele is common in blacks and is associated with higher blood pressure and an increased risk for prevalent hypertension.
15192093 in CORIN, the frizzled 1 domain and LDLR repeats 1-4 are important structural elements for recognition of the physiological substrate, pro-ANP
14559895 the transmembrane domain is not necessary for the biological activity of corin but may be a mechanism to localize corin at specific sites
12154094 These data indicate that the GATA element and its binding to GATA-4 are essential for cardiac expression of the human and murine corin genes.
11884416 Processing of pro-atrial natriuretic peptide by corin in cardiac myocytes.

AA Sequence

MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVG      1 - 70
TLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVSTAHPDQHVPAWTTDASLPGDQSHRNTSACM     71 - 140
NITHSQCQMLPYHATLTPLLSVVRNMEMEKFLKFFTYLHRLSCYQHIMLFGCTLAFPECIIDGDDSHGLL    141 - 210
PCRSFCEAAKEGCESVLGMVNYSWPDFLRCSQFRNQTESSNVSRICFSPQQENGKQLLCGRGENFLCASG    211 - 280
ICIPGKLQCNGYNDCDDWSDEAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTTEHRC    281 - 350
GDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTS    351 - 420
CQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWE    421 - 490
SSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQF    491 - 560
PEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQC    561 - 630
LKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSS    631 - 700
FLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLV    701 - 770
NGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLT    771 - 840
VAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRP    841 - 910
VCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDS    911 - 980
CMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFLLN            981 - 1042
//

Text Mined References (50)

PMID Year Title
26577631 2016 Association between serum corin levels and risk of acute myocardial infarction.
26488448 2015 Diagnostic utility of BNP, corin and furin as biomarkers for cardiovascular complications in type 2 diabetes mellitus patients.
26344336 2015 Increased serum soluble corin in dyslipidemia: A cross-sectional study.
26259032 2015 PCSK6-mediated corin activation is essential for normal blood pressure.
26086065 2015 Increased serum soluble corin in mid pregnancy is associated with hypertensive disorders of pregnancy.
26048191 2015 Increased plasma corin levels in patients with atrial fibrillation.
26022632 2015 Serum Soluble Corin is Decreased in Stroke.
25981578 2015 Circulating corin concentrations are related to infarct size in patients after ST-segment elevation myocardial infarction.
25663063 2015 Association Between High Serum Soluble Corin and Hypertension: A Cross-Sectional Study in a General Population of China.
25649697 2015 Plasma corin decreases after coronary artery bypass graft surgery and is associated with postoperative heart failure: a pilot study.
25516437 2014 Regulated inositol-requiring protein 1-dependent decay as a mechanism of corin RNA and protein deficiency in advanced human systolic heart failure.
25488193 2014 A corin variant identified in hypertensive patients that alters cytoplasmic tail and reduces cell surface expression and activity.
25474356 2014 Highly significant association between two common single nucleotide polymorphisms in CORIN gene and preeclampsia in Caucasian women.
25451932 2015 Distinct roles of N-glycosylation at different sites of corin in cell membrane targeting and ectodomain shedding.
24828501 2014 Corin mutations K317E and S472G from preeclamptic patients alter zymogen activation and cell surface targeting. [Corrected].
24100222 2013 Corin: a new player in the regulation of salt-water balance and blood pressure.
24015598 2013 BNP molecular forms and processing by the cardiac serine protease corin.
23434834 2013 Corin, an enzyme with a putative role in spiral artery remodeling, is up-regulated in late secretory endometrium and first trimester decidua.
23372161 2013 Corin mutation R539C from hypertensive patients impairs zymogen activation and generates an inactive alternative ectodomain fragment.
23327554 2013 Reduced urinary corin levels in patients with chronic kidney disease.
22987923 2012 Salt-sensitive hypertension and cardiac hypertrophy in transgenic mice expressing a corin variant identified in blacks.
22437503 2012 Role of corin in trophoblast invasion and uterine spiral artery remodelling in pregnancy.
22093942 2012 Corin in clinical laboratory diagnostics.
21518754 2011 Human corin isoforms with different cytoplasmic tails that alter cell surface targeting.
21288900 2011 Ectodomain shedding and autocleavage of the cardiac membrane protease corin.
21216831 2011 Decompensated heart failure is associated with reduced corin levels and decreased cleavage of pro-atrial natriuretic peptide.
20802129 2010 Protease corin expression and activity in failing hearts.
20670840 2010 Plasma corin levels provide minimal prognostic utility incremental to natriuretic peptides in chronic systolic heart failure.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20613715 2010 Decreased renal corin expression contributes to sodium retention in proteinuric kidney diseases.
19919978 2009 Dysfunctional corin i555(p568) allele is associated with impaired brain natriuretic peptide processing and adverse outcomes in blacks with systolic heart failure: results from the Genetic Risk Assessment in Heart Failure substudy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19751717 2009 Enzyme-linked immunoabsorbent assay for detection of human serine protease corin in blood.
19326473 2009 Natriuretic peptide system gene variants are associated with ventricular dysfunction after coronary artery bypass grafting.
18669922 2008 Corin variant associated with hypertension and cardiac hypertrophy exhibits impaired zymogen activation and natriuretic peptide processing activity.
17918732 2008 An integrated genetic and functional analysis of the role of type II transmembrane serine proteases (TMPRSSs) in hearing loss.
17890485 2007 Expression and secretion of the atrial natriuretic peptide in human adipose tissue and preadipocytes.
17660514 2007 Role of glycosylation in corin zymogen activation.
17296875 2007 Corin I555(P568) allele is associated with enhanced cardiac hypertrophic response to increased systemic afterload.
16216958 2005 Corin gene minor allele defined by 2 missense mutations is common in blacks and associated with high blood pressure and hypertension.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15192093 2004 Identification of domain structures in the propeptide of corin essential for the processing of proatrial natriuretic peptide.
14559895 2003 Functional analysis of the transmembrane domain and activation cleavage of human corin: design and characterization of a soluble corin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12154094 2002 Genomic structures of the human and murine corin genes and functional GATA elements in their promoters.
11884416 2002 Processing of pro-atrial natriuretic peptide by corin in cardiac myocytes.
11082206 2000 Localization of the mosaic transmembrane serine protease corin to heart myocytes.
10880574 2000 Corin, a transmembrane cardiac serine protease, acts as a pro-atrial natriuretic peptide-converting enzyme.
10329693 1999 Corin, a mosaic transmembrane serine protease encoded by a novel cDNA from human heart.