Property Summary

NCBI Gene PubMed Count 22
PubMed Score 145.48
PubTator Score 25.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 2.1e-09
malignant mesothelioma 3163 4.5e-06
psoriasis 6685 3.8e-05
Disease Target Count
Coenzyme Q10 deficiency, primary, 8 1

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 4.5e-06
psoriasis -1.900 3.8e-05
osteosarcoma -2.366 2.1e-09

Protein-protein Interaction (2)

Gene RIF (5)

PMID Text
25339443 Mitochondrial COQ9 is a lipid-binding protein that associates with COQ7 to enable coenzyme Q biosynthesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
19135146 The siRNA-mediated knock down leads to an increase in cytoplasmic superoxide dismutase (SOD1) mRNA levels and activity
18927074 action of clioquinol on several age-dependent neurodegenerative diseases with distinct etiologies might result from a slowing down of the aging process through action of the drug on CLK-1.

AA Sequence

MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQ      1 - 70
MAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVA     71 - 140
VEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVA    141 - 210
IYLSERL                                                                   211 - 217
//

Text Mined References (29)

PMID Year Title
26084283 2015 Rescue of primary ubiquinone deficiency due to a novel COQ7 defect using 2,4-dihydroxybensoic acid.
25961505 2015 A nuclear role for the respiratory enzyme CLK-1 in regulating mitochondrial stress responses and longevity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25339443 2014 Mitochondrial COQ9 is a lipid-binding protein that associates with COQ7 to enable coenzyme Q biosynthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270420 2013 ADCK4 mutations promote steroid-resistant nephrotic syndrome through CoQ10 biosynthesis disruption.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19135146 2009 Superoxide dismutase is regulated by LAMMER kinase in Drosophila and human cells.
18927074 2009 The anti-neurodegeneration drug clioquinol inhibits the aging-associated protein CLK-1.
16381901 2006 The LIFEdb database in 2006.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11749961 2001 CLK-1/Coq7p is a DMQ mono-oxygenase and a new member of the di-iron carboxylate protein family.
11511092 2001 Mouse coq7/clk-1 orthologue rescued slowed rhythmic behavior and extended life span of clk-1 longevity mutant in Caenorhabditis elegans.
11435415 2001 A new member of the family of di-iron carboxylate proteins. Coq7 (clk-1), a membrane-bound hydroxylase involved in ubiquinone biosynthesis.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10501970 1999 Conservation of the Caenorhabditis elegans timing gene clk-1 from yeast to human: a gene required for ubiquinone biosynthesis with potential implications for aging.
10373327 1999 Orthologues of the Caenorhabditis elegans longevity gene clk-1 in mouse and human.
10373325 1999 Identification and chromosomal location of two human genes encoding enzymes potentially involved in proteolytic maturation of farnesylated proteins.
9452453 1998 Yeast Clk-1 homologue (Coq7/Cat5) is a mitochondrial protein in coenzyme Q synthesis.
9020081 1997 Structural and functional conservation of the Caenorhabditis elegans timing gene clk-1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.