Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.17
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2844 3.8e-37
acute quadriplegic myopathy 1157 6.0e-08
osteosarcoma 7933 2.7e-05

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.203 2.7e-05
acute quadriplegic myopathy -1.978 6.0e-08
lung carcinoma 1.600 3.8e-37

Gene RIF (10)

PMID Text
26768296 In conclusion, urinary CoQ analysis is a noninvasive, reliable, and reproducible method to determine urinary tract CoQ status.
26107394 Report age-related increase in oxidized proportion of muscle coenzyme Q10.
25800618 Effect of Coenzyme Q10 on Th1/Th2 Paradigm in Females with Idiopathic Recurrent Pregnancy Loss
25463064 Serum coenzyme Q10 levels were inversely associated with risk of disabling dementia.
23494902 When a childhood mitochondrial disorder is suspected, an increased frequency of type 2C fibers in morphologically normal muscle suggests CoQ10 deficiency.
22645453 coenzyme Q10, superoxide dismutase, and oxidative stress have roles in coronary artery disease, but the effect of malondialdehyde, catalase, and glutathione peroxidase is not significant
21640350 plasma coenzyme Q10, asymmetric dimethylarginine and arterial stiffness in patients have a role in phenotypic or genotypic familial hypercholesterolemia with long-term statin therapy
21458815 Rosuvastatin combined with regular exercise preserves coenzyme Q10 levels associated with a significant increase in high-density lipoprotein cholesterol in patients with coronary artery disease
20877624 Observational study of gene-disease association. (HuGE Navigator)
19891963 Results show no significant differences in paraoxonase, oxLDL, or other oxidative stress markers after 2 months of acetylsalicylic acid treatment.

AA Sequence

MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSS      1 - 70
RSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPP     71 - 140
VMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFF    141 - 210
DEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT                                     211 - 247
//

Text Mined References (16)

PMID Year Title
26768296 Determination of urinary coenzyme Q10 by HPLC with electrochemical detection: Reference values for a paediatric population.
26107394 2015 Oxidized proportion of muscle coenzyme Q10 increases with age in healthy children.
25800618 2015 Effect of Coenzyme Q10 on Th1/Th2 Paradigm in Females with Idiopathic Recurrent Pregnancy Loss.
25463064 2014 Serum coenzyme Q10 and risk of disabling dementia: the Circulatory Risk in Communities Study (CIRCS).
23494902 2013 Coenzyme Q10 deficiency in children: frequent type 2C muscle fibers with normal morphology.
22645453 2012 The relationship between coenzyme Q10, oxidative stress, and antioxidant enzymes activities and coronary artery disease.
21640350 2011 Relationship between plasma coenzyme Q10, asymmetric dimethylarginine and arterial stiffness in patients with phenotypic or genotypic familial hypercholesterolemia on long-term statin therapy.
21458815 2011 Rosuvastatin combined with regular exercise preserves coenzyme Q10 levels associated with a significant increase in high-density lipoprotein cholesterol in patients with coronary artery disease.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19891963 2010 Effects of acetylsalicylic acid on serum paraoxonase activity, Ox-LDL, coenzyme Q10 and other oxidative stress markers in healthy volunteers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16230336 2005 The Saccharomyces cerevisiae COQ10 gene encodes a START domain protein required for function of coenzyme Q in respiration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.