Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.41
PubTator Score 1.34

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (10)

Gene RIF (2)

AA Sequence

MQRPEAWPRPHPGEGAAAAQAGGPAPPARAGEPSGLRLQEPSLYTIKAVFILDNDGRRLLAKYYDDTFPS      1 - 70
MKEQMVFEKNVFNKTSRTESEIAFFGGMTIVYKNSIDLFLYVVGSSYENELMLMSVLTCLFESLNHMLRK     71 - 140
NVEKRWLLENMDGAFLVLDEIVDGGVILESDPQQVIQKVNFRADDGGLTEQSVAQVLQSAKEQIKWSLLK    141 - 210
//

Text Mined References (9)

PMID Year Title