Property Summary

NCBI Gene PubMed Count 25
PubMed Score 43.17
PubTator Score 13.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.100 4.1e-03
group 3 medulloblastoma 1.200 3.2e-03
Multiple myeloma 1.416 8.5e-05
osteosarcoma 1.831 1.1e-04
ovarian cancer -1.900 1.4e-07
pancreatic ductal adenocarcinoma liver m... -1.277 2.0e-02

Protein-protein Interaction (10)

Gene RIF (3)

AA Sequence

MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYK      1 - 70
SSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQ     71 - 140
QVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR                                     141 - 177
//

Text Mined References (32)

PMID Year Title