Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.92
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 4 medulloblastoma 1855 2.6e-05
breast carcinoma 1638 2.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.500 2.8e-03
group 4 medulloblastoma -1.200 2.6e-05

Gene RIF (1)

AA Sequence

MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ                   1 - 57
//

Text Mined References (6)

PMID Year Title