Property Summary

NCBI Gene PubMed Count 38
PubMed Score 15.84
PubTator Score 92.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.122 5.8e-05
adult high grade glioma -1.100 4.9e-03
Alzheimer's disease -1.200 3.1e-02
astrocytic glioma -2.000 2.3e-02
Astrocytoma, Pilocytic -1.200 2.0e-04
atypical teratoid / rhabdoid tumor -1.700 2.2e-05
ependymoma -1.600 2.3e-02
glioblastoma -1.100 2.4e-04
lung cancer 1.200 4.5e-03
malignant mesothelioma -1.100 5.2e-06
medulloblastoma -1.100 7.5e-04
medulloblastoma, large-cell -1.400 6.5e-03
oligodendroglioma -1.300 2.7e-02
osteosarcoma 1.374 9.9e-04
ovarian cancer -1.600 3.0e-07
pancreatic cancer 1.100 2.9e-02
Pick disease -1.200 4.6e-04
primitive neuroectodermal tumor -1.100 1.9e-02

Gene RIF (8)

AA Sequence

MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSE      1 - 70
LGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLP     71 - 140
VEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN     141 - 209
//

Text Mined References (46)

PMID Year Title