Property Summary

NCBI Gene PubMed Count 21
PubMed Score 28.97
PubTator Score 2.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.500 1.3e-04
sonic hedgehog group medulloblastoma -1.100 4.1e-06
ovarian cancer 1.700 6.1e-05

Protein-protein Interaction (5)

AA Sequence

MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVF      1 - 70
AYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADV     71 - 140
LRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIE    141 - 210
SEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN         211 - 275
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19141280 2009 Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality.
18926707 2008 The COP9 signalosome: more than a protease.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15502821 2004 A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647295 2003 The COP9 signalosome: an assembly and maintenance platform for cullin ubiquitin ligases?
12732143 2003 The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.
12628923 2003 Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220626 2002 Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome.
12020345 2002 Polyamine-modulated factor 1 binds to the human homologue of the 7a subunit of the Arabidopsis COP9 signalosome: implications in gene expression.
11337588 2001 Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome.
11285227 2001 COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system.
9707402 1998 The COP9 complex is conserved between plants and mammals and is related to the 26S proteasome regulatory complex.
9535219 1998 A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits.