| Tbio | COP9 signalosome complex subunit 6 |
Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Has some glucocorticoid receptor-responsive activity. Stabilizes RFWD2/COP1 through reducing RFWD2 auto-ubiquitination and decelerating RFWD2 turnover rate, hence regulates the ubiquitination of RFWD2 targets.
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count |
|---|---|
| HIV Infections | 99 |
| Disease | Target Count | P-value |
|---|---|---|
| ovarian cancer | 8491 | 3.5e-05 |
| Multiple myeloma | 1327 | 5.8e-04 |
| Disease | log2 FC | p |
|---|---|---|
| Multiple myeloma | 1.402 | 5.8e-04 |
| ovarian cancer | 2.200 | 3.5e-05 |
| PMID | Text | |
|---|---|---|
| 26318036 | our results indicate that CSN6 is a positive regulator of E6AP and is important for cervical cancer development. | |
| 26267535 | Findings indicate that the deregulation of beta-catenin by extracellular signal-regulated kinase 2 (ERK2)-activated CSN6 protein is important for colorectal cancer (CRC) development. | |
| 26237449 | CSN6 positively regulates c-Jun in a MEKK1-dependent manner | |
| 25945542 | CSN6 interacts with p27(Kip1) and facilitates ubiquitin-mediated degradation of p27(Kip1). | |
| 25242525 | Analyses of the pseudo metal-binding motif in CSN6 suggest that the loss of two key histidine residues may contribute to the lack of catalytic activity in CSN6. | |
| 23187808 | Data suggest that CSN6 is an important negative regulator of p57 (Kip2) , and that overexpression of CSN6 in many types of cancer could lead to decreased expression of p57 (Kip2) and result in promoted cancer cell growth. | |
| 22190034 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 21555518 | COPS6 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells. | |
| 21317535 | loss of CSN6 enhances p53-mediated tumor suppression in vivo and CSN6 plays an important role in regulating DNA damage-associated apoptosis and tumorigenesis through control of the MDM2-p53 signaling pathway | |
| 18060501 | For the first time our data demonstrate that CSN-mediated deneddylation can be regulated by active Casp3 and that the CSN executes a specific function during the apoptotic process. | |
| 17337451 | critical role of caspase 8 in the processing of CSN6. | |
| 15832179 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 12237292 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 11531413 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 10958988 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 9520381 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 9094673 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 7666531 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 7494303 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 7474100 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses | |
| 7474080 | HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses |
MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIG 1 - 70 ALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHK 71 - 140 QVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATG 141 - 210 SGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFY 211 - 280 DQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF 281 - 327 //
| PMID | Year | Title | |
|---|---|---|---|
| 26456823 | 2015 | CSNAP Is a Stoichiometric Subunit of the COP9 Signalosome. | |
| 26318036 | 2015 | COP9 signalosome subunit 6 (CSN6) regulates E6AP/UBE3A in cervical cancer. | |
| 26267535 | 2015 | ERK2-Dependent Phosphorylation of CSN6 Is Critical in Colorectal Cancer Development. | |
| 26237449 | 2015 | CSN6 positively regulates c-Jun in a MEKK1-dependent manner. | |
| 25945542 | 2015 | Regulating the stability and localization of CDK inhibitor p27(Kip1) via CSN6-COP1 axis. | |
| 25242525 | 2014 | Crystal structure of the human CSN6 MPN domain. | |
| 24421388 | 2014 | Dynamic regulation of the COP9 signalosome in response to DNA damage. | |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. | |
| 23376485 | 2013 | Proteomic analysis of podocyte exosome-enriched fraction from normal human urine. | |
| 23187808 | 2012 | CDK inhibitor p57 (Kip2) is negatively regulated by COP9 signalosome subunit 6. | |
| 21625211 | 2011 | COP9 signalosome subunit 6 stabilizes COP1, which functions as an E3 ubiquitin ligase for 14-3-3?. | |
| 21555518 | 2011 | The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle. | |
| 21317535 | 2011 | Subunit 6 of the COP9 signalosome promotes tumorigenesis in mice through stabilization of MDM2 and is upregulated in human cancers. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 19615732 | 2009 | Defining the human deubiquitinating enzyme interaction landscape. | |
| 19141280 | 2009 | Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality. | |
| 18850735 | 2008 | Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry. | |
| 18060501 | 2008 | The COP9 signalosome-mediated deneddylation is stimulated by caspases during apoptosis. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17337451 | 2007 | The subunit CSN6 of the COP9 signalosome is cleaved during apoptosis. | |
| 16169070 | 2005 | A human protein-protein interaction network: a resource for annotating the proteome. | |
| 15757663 | 2005 | Binding of JAB1/CSN5 to MIF is mediated by the MPN domain but is independent of the JAMM motif. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15383276 | 2004 | A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease. | |
| 14667819 | 2004 | Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region. | |
| 14647295 | 2003 | The COP9 signalosome: an assembly and maintenance platform for cullin ubiquitin ligases? | |
| 12732143 | 2003 | The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage. | |
| 12690205 | 2003 | Human chromosome 7: DNA sequence and biology. | |
| 12628923 | 2003 | Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome. | |
| 12615944 | 2003 | Characterization of the last subunit of the Arabidopsis COP9 signalosome: implications for the overall structure and origin of the complex. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12446680 | 2003 | The p34cdc2-related cyclin-dependent kinase 11 interacts with the p47 subunit of eukaryotic initiation factor 3 during apoptosis. | |
| 12237292 | 2002 | Carboxyl terminus of hVIP/mov34 is critical for HIV-1-Vpr interaction and glucocorticoid-mediated signaling. | |
| 12220626 | 2002 | Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome. | |
| 11531413 | 2001 | HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25. | |
| 11337588 | 2001 | Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome. | |
| 11285227 | 2001 | COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system. | |
| 11244567 | 2001 | Choice of expression vector alters the localization of a human cellular protein. | |
| 10958988 | 2000 | Cell cycle G2 arrest induced by HIV-1 Vpr in fission yeast (Schizosaccharomyces pombe) is independent of cell death and early genes in the DNA damage checkpoint. | |
| 9707402 | 1998 | The COP9 complex is conserved between plants and mammals and is related to the 26S proteasome regulatory complex. | |
| 9535219 | 1998 | A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits. | |
| 9520381 | 1998 | HIV-1 Vpr interacts with a human 34-kDa mov34 homologue, a cellular factor linked to the G2/M phase transition of the mammalian cell cycle. | |
| 9341143 | 1997 | Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly. | |
| 9094673 | 1997 | Human immunodeficiency virus type 1 vpr gene induces phenotypic effects similar to those of the DNA alkylating agent, nitrogen mustard. | |
| 8195203 | 1994 | Biochemical mechanism of HIV-I Vpr function. Specific interaction with a cellular protein. | |
| 7666531 | 1995 | The human immunodeficiency virus type 1 vpr gene arrests infected T cells in the G2 + M phase of the cell cycle. | |
| 7494303 | 1995 | Mutational analysis of cell cycle arrest, nuclear localization and virion packaging of human immunodeficiency virus type 1 Vpr. | |
| 7474100 | 1995 | Human immunodeficiency virus type 1 Vpr arrests the cell cycle in G2 by inhibiting the activation of p34cdc2-cyclin B. | |
| 7474080 | 1995 | Human immunodeficiency virus type 1 viral protein R (Vpr) arrests cells in the G2 phase of the cell cycle by inhibiting p34cdc2 activity. | |
| 1222062 | 1975 | [Distribution pattern of rigor mortis in various joint regions]. |
