Property Summary

NCBI Gene PubMed Count 48
PubMed Score 30.21
PubTator Score 16.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
HIV Infections 99
Disease Target Count P-value
ovarian cancer 8491 3.5e-05
Multiple myeloma 1327 5.8e-04

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.402 5.8e-04
ovarian cancer 2.200 3.5e-05

Gene RIF (21)

PMID Text
26318036 our results indicate that CSN6 is a positive regulator of E6AP and is important for cervical cancer development.
26267535 Findings indicate that the deregulation of beta-catenin by extracellular signal-regulated kinase 2 (ERK2)-activated CSN6 protein is important for colorectal cancer (CRC) development.
26237449 CSN6 positively regulates c-Jun in a MEKK1-dependent manner
25945542 CSN6 interacts with p27(Kip1) and facilitates ubiquitin-mediated degradation of p27(Kip1).
25242525 Analyses of the pseudo metal-binding motif in CSN6 suggest that the loss of two key histidine residues may contribute to the lack of catalytic activity in CSN6.
23187808 Data suggest that CSN6 is an important negative regulator of p57 (Kip2) , and that overexpression of CSN6 in many types of cancer could lead to decreased expression of p57 (Kip2) and result in promoted cancer cell growth.
22190034 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21555518 COPS6 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21317535 loss of CSN6 enhances p53-mediated tumor suppression in vivo and CSN6 plays an important role in regulating DNA damage-associated apoptosis and tumorigenesis through control of the MDM2-p53 signaling pathway
18060501 For the first time our data demonstrate that CSN-mediated deneddylation can be regulated by active Casp3 and that the CSN executes a specific function during the apoptotic process.
17337451 critical role of caspase 8 in the processing of CSN6.
15832179 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12237292 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
11531413 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
10958988 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9520381 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
9094673 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
7666531 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
7494303 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
7474100 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
7474080 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 6 (COPS6) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIG      1 - 70
ALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHK     71 - 140
QVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATG    141 - 210
SGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFY    211 - 280
DQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF                           281 - 327
//

Text Mined References (50)

PMID Year Title
26456823 2015 CSNAP Is a Stoichiometric Subunit of the COP9 Signalosome.
26318036 2015 COP9 signalosome subunit 6 (CSN6) regulates E6AP/UBE3A in cervical cancer.
26267535 2015 ERK2-Dependent Phosphorylation of CSN6 Is Critical in Colorectal Cancer Development.
26237449 2015 CSN6 positively regulates c-Jun in a MEKK1-dependent manner.
25945542 2015 Regulating the stability and localization of CDK inhibitor p27(Kip1) via CSN6-COP1 axis.
25242525 2014 Crystal structure of the human CSN6 MPN domain.
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23187808 2012 CDK inhibitor p57 (Kip2) is negatively regulated by COP9 signalosome subunit 6.
21625211 2011 COP9 signalosome subunit 6 stabilizes COP1, which functions as an E3 ubiquitin ligase for 14-3-3?.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21317535 2011 Subunit 6 of the COP9 signalosome promotes tumorigenesis in mice through stabilization of MDM2 and is upregulated in human cancers.
21269460 2011 Initial characterization of the human central proteome.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19141280 2009 Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18060501 2008 The COP9 signalosome-mediated deneddylation is stimulated by caspases during apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17337451 2007 The subunit CSN6 of the COP9 signalosome is cleaved during apoptosis.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15757663 2005 Binding of JAB1/CSN5 to MIF is mediated by the MPN domain but is independent of the JAMM motif.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14647295 2003 The COP9 signalosome: an assembly and maintenance platform for cullin ubiquitin ligases?
12732143 2003 The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12628923 2003 Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome.
12615944 2003 Characterization of the last subunit of the Arabidopsis COP9 signalosome: implications for the overall structure and origin of the complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446680 2003 The p34cdc2-related cyclin-dependent kinase 11 interacts with the p47 subunit of eukaryotic initiation factor 3 during apoptosis.
12237292 2002 Carboxyl terminus of hVIP/mov34 is critical for HIV-1-Vpr interaction and glucocorticoid-mediated signaling.
12220626 2002 Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome.
11531413 2001 HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25.
11337588 2001 Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome.
11285227 2001 COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system.
11244567 2001 Choice of expression vector alters the localization of a human cellular protein.
10958988 2000 Cell cycle G2 arrest induced by HIV-1 Vpr in fission yeast (Schizosaccharomyces pombe) is independent of cell death and early genes in the DNA damage checkpoint.
9707402 1998 The COP9 complex is conserved between plants and mammals and is related to the 26S proteasome regulatory complex.
9535219 1998 A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits.
9520381 1998 HIV-1 Vpr interacts with a human 34-kDa mov34 homologue, a cellular factor linked to the G2/M phase transition of the mammalian cell cycle.
9341143 1997 Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.
9094673 1997 Human immunodeficiency virus type 1 vpr gene induces phenotypic effects similar to those of the DNA alkylating agent, nitrogen mustard.
8195203 1994 Biochemical mechanism of HIV-I Vpr function. Specific interaction with a cellular protein.
7666531 1995 The human immunodeficiency virus type 1 vpr gene arrests infected T cells in the G2 + M phase of the cell cycle.
7494303 1995 Mutational analysis of cell cycle arrest, nuclear localization and virion packaging of human immunodeficiency virus type 1 Vpr.
7474100 1995 Human immunodeficiency virus type 1 Vpr arrests the cell cycle in G2 by inhibiting the activation of p34cdc2-cyclin B.
7474080 1995 Human immunodeficiency virus type 1 viral protein R (Vpr) arrests cells in the G2 phase of the cell cycle by inhibiting p34cdc2 activity.
1222062 1975 [Distribution pattern of rigor mortis in various joint regions].