Property Summary

NCBI Gene PubMed Count 42
PubMed Score 7.80
PubTator Score 363.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.148 3.4e-02
Multiple myeloma 2.366 2.6e-04
hereditary spastic paraplegia -1.091 7.6e-03
tuberculosis and treatment for 6 months 1.400 8.9e-06
ovarian cancer -1.700 2.1e-05

Gene RIF (12)

PMID Text
23441852 p300 binds to Alien alpha by pull down (View interaction) Alien alpha physically interacts with CBP by two hybrid
22190034 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 2 (COPS2; CSN2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19535905 A subunit of the COP9 signalosome interacted physically with the anaphase-promoting complex and showed a genetic instability of cells.
19400951 CSN2 knockdown cells underwent non-apoptotic cell death.
18174916 Alien seems to modulate nucleosome assembly activity. This suggests that Alien is acting on chromatin not only through recruitment of histone-modifying activities, but also through enhancing nucleosome assembly.
17968325 CSN2 gene was identified in the genome-wide loss-of-function genetic screen as putative tumor suppressor located at 15q21.2.
17929852 the interaction between Alien and the tumor suppressors p33ING1 and p33ING2 reveals a novel cellular protein network
17570542 Alien inhibits E2F1 gene expression and cell proliferation.
17438371 Protein interactions of Alien involving nucleophosmin, ERCC3, TRIP11, as well as CRSP3.
17339334 Data show that Alien binds in vivo and in vitro to NAP1 and modulates its activity by enhancing NAP1-mediated nucleosome assembly on DNA.
15173382 Alien and Sin3A reside together in vivo with the vitamin D3 receptor on the human 24-hydroxylase (CYP24) promoter containing vitamin D3 response elements by chromatin immunoprecipitation
15062575 demonstrate Alien-MLK2 interaction and also show that MLK2 is able to phosphorylate Alien; Alien, DAX-1 and thyroid hormone receptor mediated transcriptional silencing is strongly enhanced in the presence of active MLK2

AA Sequence

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFK      1 - 70
ALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALK     71 - 140
DAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKN    141 - 210
NKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYL    211 - 280
VLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEEL    281 - 350
LRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGAR    351 - 420
YTALDKWTNQLNSLNQAVVSKLA                                                   421 - 443
//

Text Mined References (44)

PMID Year Title
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23441852 2013 The corepressor activity of Alien is controlled by CREB-binding protein/p300.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21269460 2011 Initial characterization of the human central proteome.
19535905 2009 Regulation of the anaphase-promoting complex by the COP9 signalosome.
19400951 2009 Analysis of the role of COP9 Signalosome (CSN) subunits in K562; the first link between CSN and autophagy.
19141280 2009 Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18174916 2007 The coregulator Alien.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17968325 2008 Cellular senescence bypass screen identifies new putative tumor suppressor genes.
17929852 2007 The tumor suppressors p33ING1 and p33ING2 interact with alien in vivo and enhance alien-mediated gene silencing.
17570542 2007 Alien inhibits E2F1 gene expression and cell proliferation.
17438371 2007 Detection and identification of transcription factors as interaction partners of alien in vivo.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17339334 2007 The nucleosome assembly activity of NAP1 is enhanced by Alien.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304329 2004 Hepatopoietin interacts directly with COP9 signalosome and regulates AP-1 activity.
15173382 2004 The highly conserved region of the co-repressor Sin3A functionally interacts with the co-repressor Alien.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15062575 2003 Mixed lineage kinase 2 enhances trans-repression of Alien and nuclear receptors.
14647295 2003 The COP9 signalosome: an assembly and maintenance platform for cullin ubiquitin ligases?
12732143 2003 The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.
12628923 2003 Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome.
12615944 2003 Characterization of the last subunit of the Arabidopsis COP9 signalosome: implications for the overall structure and origin of the complex.
12522100 2003 The role of transcriptional corepressor Nif3l1 in early stage of neural differentiation via cooperation with Trip15/CSN2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220626 2002 Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome.
11337588 2001 Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome.
11285227 2001 COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system.
11114242 2001 The subunit 1 of the COP9 signalosome suppresses gene expression through its N-terminal domain and incorporates into the complex through the PCI domain.
10991940 2000 Interaction between interferon consensus sequence-binding protein and COP9/signalosome subunit CSN2 (Trip15). A possible link between interferon regulatory factor signaling and the COP9/signalosome.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10713076 2000 Interaction of the corepressor Alien with DAX-1 is abrogated by mutations of DAX-1 involved in adrenal hypoplasia congenita.
10585392 1999 COP9 signalosome-directed c-Jun activation/stabilization is independent of JNK.
10207062 1999 Alien, a highly conserved protein with characteristics of a corepressor for members of the nuclear hormone receptor superfamily.
10087198 1999 Coding sequence, genomic organization, chromosomal localization, and expression pattern of the signalosome component Cops2: the mouse homologue of Drosophila alien.
9707402 1998 The COP9 complex is conserved between plants and mammals and is related to the 26S proteasome regulatory complex.
9535219 1998 A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7776974 1995 Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor.