Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.80
PubTator Score 2.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 1.3e-06
sonic hedgehog group medulloblastoma 459 2.1e-05
cystic fibrosis 1629 3.4e-05
osteosarcoma 7766 1.2e-02
Disease Target Count Z-score Confidence
Neurofibroma 8 3.798 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.029 3.4e-05
osteosarcoma 1.175 1.2e-02
ovarian cancer -1.100 1.3e-06
sonic hedgehog group medulloblastoma -1.200 2.1e-05

 GO Function (1)

AA Sequence

MDLQAAGAQAQGAAEPSRGPPLPSARGAPPSPEAGFATADHSSQERETEKAMDRLARGTQSIPNDSPARG      1 - 70
EGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKEQPGDLFNEDWDSELKADQGNPYDADDIQESISQE     71 - 140
LKPWVCCAPQGDMIYDPSWHHPPPLIPYYSKMVFETGQFDDAED                              141 - 184
//

Text Mined References (10)

PMID Year Title