Property Summary

NCBI Gene PubMed Count 22
PubMed Score 10.79
PubTator Score 9.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis 1.700 1.4e-03
group 3 medulloblastoma 2.300 1.9e-04
tuberculosis 1.800 4.1e-09
interstitial cystitis -1.200 1.4e-02
cystic fibrosis 1.400 1.5e-04
pituitary cancer 1.300 2.3e-03

Gene RIF (2)

PMID Text
22456293 In cortices, the MEST promoter was hemimethylated, as expected for a differentially methylated imprinting control region, whereas the COPG2 and TSGA14 promoters were completely demethylated, typical for transcriptionally active non-imprinted genes.
11920156 Mutation sscreening and imprinting analysis of candidate genes for autism in the 7q32 region

AA Sequence

MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAF      1 - 70
FAMTRLFQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTMLQAI     71 - 140
ERYMKQAIVDKVSSVSSSALVSSLHMMKISYDVVKRWINEAQEAASSDNIMVQYHALGVLYHLRKNDRLA    141 - 210
VSKMLNKFTKSGLKSQFAYCMLIRIASRLLKETEDGHESPLFDFIESCLRNKHEMVIYEAASAIIHLPNC    211 - 280
TARELAPAVSVLQLFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLK    281 - 350
TGSESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEYKRAIVDC    351 - 420
IISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYIRFIFNRVVLENEAVRAA    421 - 490
AVSALAKFGAQNESLLPSILVLLQRCMMDTDDEVRDRATFYLNVLQQRQMALNATYIFNGLTVSVPGMEK    491 - 560
ALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKPEKLAPSRQDIFQEQLAAIPEFLNIGPLFKS    561 - 630
SEPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQP    631 - 700
GICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFA    701 - 770
AAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVR    771 - 840
SRLALADGVTMQVTVRSKERTPVDVILASVG                                           841 - 871
//

Text Mined References (27)

PMID Year Title
25129144 2014 JAGN1 deficiency causes aberrant myeloid cell homeostasis and congenital neutropenia.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22456293 2012 Methylation and expression analyses of the 7q autism susceptibility locus genes MEST , COPG2, and TSGA14 in human and anthropoid primate cortices.
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14729954 2004 Novel isotypic gamma/zeta subunits reveal three coatomer complexes in mammals.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11920156 2002 Mutation screening and imprinting analysis of four candidate genes for autism in the 7q32 region.
11893085 2002 Interaction of gamma-COP with a transport motif in the D1 receptor C-terminus.
11884415 2002 Association of tapasin and COPI provides a mechanism for the retrograde transport of major histocompatibility complex (MHC) class I molecules from the Golgi complex to the endoplasmic reticulum.
11409905 2001 Similar subunit interactions contribute to assembly of clathrin adaptor complexes and COPI complex: analysis using yeast three-hybrid system.
11056392 2000 Identification and characterization of novel isoforms of COP I subunits.
11030615 2000 The debate about transport in the Golgi--two sides of the same coin?
10995575 2000 The novel gene, gamma2-COP (COPG2), in the 7q32 imprinted domain escapes genomic imprinting.
10921873 2000 COP I domains required for coatomer integrity, and novel interactions with ARF and ARF-GAP.
10556286 1999 gamma2-COP, a novel imprinted gene on chromosome 7q32, defines a new imprinting cluster in the human genome.
10318838 1999 GTP-dependent binding of ADP-ribosylation factor to coatomer in close proximity to the binding site for dilysine retrieval motifs and p23.
9751720 1998 A single binding site for dilysine retrieval motifs and p23 within the gamma subunit of coatomer.
8940050 1996 In vivo assembly of coatomer, the COP-I coat precursor.
1898986 1991 'Coatomer': a cytosolic protein complex containing subunits of non-clathrin-coated Golgi transport vesicles.
1472999 1992 Afferent innervation of the vestibular nuclei in the chinchilla. II. Description of the vestibular nerve and nuclei.