Property Summary

NCBI Gene PubMed Count 27
PubMed Score 40.66
PubTator Score 1295.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis -1.600 7.4e-03
Multiple myeloma 1.168 5.9e-03
osteosarcoma 1.284 4.5e-07
pancreatic ductal adenocarcinoma liver m... -1.308 1.2e-02
diabetes mellitus -1.100 3.3e-03
posterior fossa group B ependymoma 1.100 6.5e-08
lung adenocarcinoma 1.100 1.1e-03
ovarian cancer 1.600 2.3e-05

Gene RIF (3)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
19632984 Data show that iPLA(1)gamma is a novel membrane transport factor that contributes to a specific Golgi-to-ER retrograde pathway distinct from presently characterized COPI- and Rab6-dependent pathways.
17721809 Ubiquitylation of epsilon-COP by PIRH2; overexpression of the wild type of PIRH2 in prostate cancer cells causes downregulation of the secretion of prostate-specific antigen.

AA Sequence

MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVL      1 - 70
DEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRAL     71 - 140
HQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMAD    141 - 210
KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDA    211 - 280
HRSHPFIKEYQAKENDFDRLVLQYAPSA                                              281 - 308
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19632984 2009 Intracellular phospholipase A1gamma (iPLA1gamma) is a novel factor involved in coat protein complex I- and Rab6-independent retrograde transport between the endoplasmic reticulum and the Golgi complex.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17721809 2008 Ubiquitylation of epsilon-COP by PIRH2 and regulation of the secretion of PSA.
17140284 2006 Computational model explains high activity and rapid cycling of Rho GTPases within protein complexes.
16956762 2006 Insights into COPI coat assembly and function in living cells.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388752 2002 GS15 forms a SNARE complex with syntaxin 5, GS28, and Ykt6 and is implicated in traffic in the early cisternae of the Golgi apparatus.
11323436 2001 Ykt6 forms a SNARE complex with syntaxin 5, GS28, and Bet1 and participates in a late stage in endoplasmic reticulum-Golgi transport.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10921873 2000 COP I domains required for coatomer integrity, and novel interactions with ARF and ARF-GAP.
10531302 1999 The cytoplasmic coatomer protein COPI. A potential translational regulator.
10469566 1999 Segregation of COPI-rich and anterograde-cargo-rich domains in endoplasmic-reticulum-to-Golgi transport complexes.
8858162 1996 Architecture of coatomer: molecular characterization of delta-COP and protein interactions within the complex.
8599108 1996 Coat proteins and vesicle budding.
8533093 1995 The ARF1 GTPase-activating protein: zinc finger motif and Golgi complex localization.
8355790 1993 Coated vesicle assembly in the Golgi requires only coatomer and ARF proteins from the cytosol.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.