Property Summary

NCBI Gene PubMed Count 30
PubMed Score 20.82
PubTator Score 65.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.200 2.0e-05
pancreatic cancer 1.300 2.6e-03
Waldenstrons macroglobulinemia 1.055 4.5e-03
glioblastoma 1.400 8.0e-03
tuberculosis and treatment for 6 months -1.500 9.4e-06
primary pancreatic ductal adenocarcinoma -1.004 7.3e-03
non-small cell lung cancer 1.043 9.1e-25
pancreatic carcinoma 1.300 2.6e-03
ovarian cancer 2.500 2.9e-05

Gene RIF (3)

PMID Text
26423947 HIV-1 Nef weakly and directly interacts with COPB2 (beta-COP) in 293T cells and this interaction is dependent on Nef membrane localization as shown by FACS-Forster resonance energy transfer (FRET)-based and site-directed mutagenesis experiments
20362547 these data suggest that beta-COP plays a critical role in the forward transport of TREK1 channel to the plasma membrane.
18434597 Golgi organization depends on mutually interacting domains in betaCOP and p115, suggesting that vesicle tethering at the Golgi involves p115 binding to the COPI coat

AA Sequence

MPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASLYNGSVCVWNHETQTLVKTFEVCDLPVRAAKFVARKN      1 - 70
WVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIKLWDWDKKWSCSQVFEG     71 - 140
HTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRL    141 - 210
VKIWDYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHSSTYRLESTLNYGMERVWCVASL    211 - 280
RGSNNVALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGS    281 - 350
CEIYPQTIQHNPNGRFVVVCGDGEYIIYTAMALRNKSFGSAQEFAWAHDSSEYAIRESNSIVKIFKNFKE    351 - 420
KKSFKPDFGAESIYGGFLLGVRSVNGLAFYDWDNTELIRRIEIQPKHIFWSDSGELVCIATEESFFILKY    421 - 490
LSEKVLAAQETHEGVTEDGIEDAFEVLGEIQEIVKTGLWVGDCFIYTSSVNRLNYYVGGEIVTIAHLDRT    491 - 560
MYLLGYIPKDNRLYLGDKELNIISYSLLVSVLEYQTAVMRRDFSMADKVLPTIPKEQRTRVAHFLEKQGF    561 - 630
KQQALTVSTDPEHRFELALQLGELKIAYQLAVEAESEQKWKQLAELAISKCQFGLAQECLHHAQDYGGLL    631 - 700
LLATASGNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVV    701 - 770
KLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADLWPAKQYPLVTPNEERNVMEEGK    771 - 840
DFQPSRSTAQQELDGKPASPTPVIVASHTANKEEKSLLELEVDLDNLELEDIDTTDINLDEDILDD        841 - 906
//

Text Mined References (43)

PMID Year Title
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25129144 2014 JAGN1 deficiency causes aberrant myeloid cell homeostasis and congenital neutropenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22446961 2012 Two new susceptibility loci for Kawasaki disease identified through genome-wide association analysis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20362547 2010 Enhancement of TREK1 channel surface expression by protein-protein interaction with beta-COP.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18434597 2008 Coat-tether interaction in Golgi organization.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16956762 2006 Insights into COPI coat assembly and function in living cells.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14729954 2004 Novel isotypic gamma/zeta subunits reveal three coatomer complexes in mammals.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527956 2003 The human phosphatidylinositol phosphatase SAC1 interacts with the coatomer I complex.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388752 2002 GS15 forms a SNARE complex with syntaxin 5, GS28, and Ykt6 and is implicated in traffic in the early cisternae of the Golgi apparatus.
11323436 2001 Ykt6 forms a SNARE complex with syntaxin 5, GS28, and Bet1 and participates in a late stage in endoplasmic reticulum-Golgi transport.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
11030615 2000 The debate about transport in the Golgi--two sides of the same coin?
10982407 2000 RGS4 and RGS2 bind coatomer and inhibit COPI association with Golgi membranes and intracellular transport.
10921873 2000 COP I domains required for coatomer integrity, and novel interactions with ARF and ARF-GAP.
9858824 1998 Assignment of the cellular retinol-binding protein 1 gene (RBP1) and of the coatomer beta subunit gene (COPB2) to human chromosome band 3q23 by in situ hybridization.
9360998 1997 The coatomer protein beta'-COP, a selective binding protein (RACK) for protein kinase Cepsilon.
8940050 1996 In vivo assembly of coatomer, the COP-I coat precursor.
8599108 1996 Coat proteins and vesicle budding.
8537409 1995 In vitro assembly and disassembly of coatomer.
8533093 1995 The ARF1 GTPase-activating protein: zinc finger motif and Golgi complex localization.
8335000 1993 A 102 kDa subunit of a Golgi-associated particle has homology to beta subunits of trimeric G proteins.
8334999 1993 beta'-COP, a novel subunit of coatomer.