Property Summary

NCBI Gene PubMed Count 39
PubMed Score 283.33
PubTator Score 126.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.206 1.6e-05
aldosterone-producing adenoma -1.028 4.3e-02
astrocytic glioma 1.500 4.1e-03
atypical teratoid / rhabdoid tumor 1.400 2.0e-03
breast carcinoma 1.200 1.2e-11
diabetes mellitus -1.100 7.2e-03
ependymoma 1.900 1.7e-03
Gaucher disease type 1 -2.500 6.7e-03
glioblastoma 1.500 7.6e-03
group 4 medulloblastoma 1.700 1.3e-04
inflammatory breast cancer 1.100 3.0e-04
intraductal papillary-mucinous adenoma (... 1.300 7.0e-04
invasive ductal carcinoma 1.100 1.9e-02
lung adenocarcinoma 1.506 6.2e-11
malignant mesothelioma -1.300 3.4e-04
medulloblastoma, large-cell 2.000 3.4e-04
Multiple myeloma 1.019 4.2e-02
non-small cell lung cancer 1.072 2.2e-07
oligodendroglioma 2.100 8.8e-04
osteosarcoma 1.952 4.0e-06
ovarian cancer 1.800 2.1e-05
psoriasis 1.300 7.8e-07

Protein-protein Interaction (2)

Gene RIF (11)

AA Sequence

MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGG      1 - 70
DDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMC     71 - 140
AQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNW    141 - 210
AAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSK    211 - 280
RTGVQTFRRDHDRFWVLAAHPNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSK    281 - 350
DVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW    351 - 420
VARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQKRTLASVKISK    421 - 490
VKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGVFIYTTSNHIKYAVTTGDHGI    491 - 560
IRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFKLALINRKYDEVLHMVRNAKLVGQSIIAYLQ    561 - 630
KKGYPEVALHFVKDEKTRFSLALECGNIEIALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNF    631 - 700
DKLSFLYLITGNLEKLRKMMKIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEE    701 - 770
AESLKETFDPEKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTV    771 - 840
GTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAGGAEDGFFVPP    841 - 910
TKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFLQTYARGRTTYQALPCLPSMY    911 - 980
GYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVGKFEEAVEKFRSILLSVPLLVVDNKQEIAEA    981 - 1050
QQLITICREYIVGLSVETERKKLPKETLEQQKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKT   1051 - 1120
AATFARRLLELGPKPEVAQQTRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGA   1121 - 1190
CYSPEFKGQICRVTTVTEIGKDVIGLRISPLQFR                                       1191 - 1224
//

Text Mined References (55)

PMID Year Title