Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.79
PubTator Score 2.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.0e-04
ovarian cancer 8491 2.4e-03
Disease Target Count Z-score Confidence
Acute chest syndrome 9 3.488 1.7
hepatocellular carcinoma 550 3.036 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.090 1.0e-04
ovarian cancer 1.100 2.4e-03

Gene RIF (4)

PMID Text
26060140 COMMD7's binding to NEMO does not interfere with the binding to the IKKs, and that the disruption of the IKK complex through the use of the NBP competitor impairs the termination of NF-kappaB activity
23049798 COMMD7 contributes to hepatocellular carcinoma progression by reducing cell apoptosis and overcoming cell cycle arrest.
20979692 BC047440 can promote the growth and invasion of hepatocellular carcinoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEPKEVERFLAQLSEFATTNQISLGSLRS      1 - 70
IVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARWAIGQTLMINQLIDMEWK     71 - 140
FGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSMECFC              141 - 200
//

Text Mined References (18)

PMID Year Title
26060140 2016 COMMD7 as a novel NEMO interacting protein involved in the termination of NF-?B signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25355947 2015 COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23637203 2013 Functional interaction of COMMD3 and COMMD9 with the epithelial sodium channel.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23049798 2012 ShRNA-targeted COMMD7 suppresses hepatocellular carcinoma growth.
21778237 2011 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
21269460 2011 Initial characterization of the human central proteome.
20979692 2010 Expression of BC047440 protein in hepatocellular carcinoma and its relationship to prognosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15799966 2005 COMMD proteins, a novel family of structural and functional homologs of MURR1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10393949 1999 SIAH-1 promotes apoptosis and tumor suppression through a network involving the regulation of protein folding, unfolding, and trafficking: identification of common effectors with p53 and p21(Waf1).