Property Summary

NCBI Gene PubMed Count 59
PubMed Score 64.68
PubTator Score 53.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.900 3.8e-05

Gene RIF (42)

PMID Text
25520503 IkappaB-alpha protein was stabilized by COMMD1, which attenuated NF-kappaB signaling during Toll-like receptor ligand and tumor necrosis factor alpha treatment and enhanced HIV-1 latency in latently HIV-1-infected cells.
25355947 COMMD1 is directly linked to early endosomes through its interaction with a protein complex containing CCDC22, CCDC93, and C16orf62.
25074812 COMMD1 is acetylated by p300 and that acetylation protects COMMD1 from XIAP-mediated proteosomal degradation
24691167 COMMD1 is identified as a novel regulator of misfolded protein aggregation.
24625556 COMMD1 expression is associated with poor prognosis in diffuse large B-cell lymphoma
23892095 These data demonstrate the anti-inflammatory properties of COMMD1 in bronchial epithelial cells and open new therapeutic avenues in cystic fibrosis.
23677795 The role of COMMD1 in copper metabolism and it structure and function are discussed.
23515529 The results indicate a role for COMMD1 in the regulation of NKCC1 membrane expression and ubiquitination.
23364987 Placental COMMD1 expression is increased in women with severe preeclampsia compared to that found in women with normal pregnancies.
22677543 No major role can be attributed to Atox1 and COMMD in the pathophysiology or clinical variation of Wilson disease.
22130675 Clusterin and COMMD1 independently regulate degradation of the mammalian copper ATPases ATP7A and ATP7B.
21778237 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
21741370 These results suggest that COMMD1 downregulates deltaENaC activity by reducing deltaENaC surface expression through promoting internalization of surface deltaENaC to an intracellular recycling pool, possibly via enhanced ubiquitination.
21483833 Data show that COMMD1 interacts with CFTR. This interaction promotes CFTR cell surface expression as assessed by biotinylation experiments in heterologously expressing cells through regulation of CFTR ubiquitination.
21275100 We argue that COMMD1 participates in the normal disposition of copper within the hepatocyte and we speculate about that role.
20595380 COMMD1 as a novel protein regulating SOD1 activation and associate COMMD1 function with the production of free radicals.
20550661 report a single novel, putative mutation in COMMD1 in one Wilson disease (WD) patient with atypical features; absence of any other prospective mutations among 108 patients suggests that COMMD1 variants are not major contributors towards WD phenotypes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20068069 Elevated levels of sCLU promote prostate cancer cell survival by facilitating degradation of COMMD1 and I-kappaB, thereby activating the canonical NF-kappaB pathway.
20048074 These data identify a new role for COMMD1 in regulating the nuclear/nucleolar distribution of RelA
19802386 COMMD1 has a role in conjunction with HSP90beta/HSP70 in the ubiquitin and O(2)-independent regulation of HIF-1alpha
19433587 HSCARG plays critical roles in regulation of NF-kappaB in response to cellular redox changes by promoting ubiquitination and proteolysis of RelA or COMMD1
19240061 Observational study of gene-disease association. (HuGE Navigator)
18974300 Data suggest that translocation of ATP7B takes place independently of Rab7-regulated endosomal traffic, and that Murr1 plays a role in a later step of the copper excretion pathway but is not involved in the translocation of the Wilson disease protein.
18940794 COMMD1 is a scaffold protein in a distinct sub-compartment of endocytic pathway and offer first clues to its role as a regulator of structurally unrelated membrane transporters.
18795889 COMMD1 expression is controlled primarily by protein ubiquitination
18305112 the ability to promote Lys(63)-mediated polyubiquitination of COMMD1 is a novel property of ARF independent of p53
17919502 Implicate COMMD1 in the pathogenesis of Wilson's disease and indicate that COMMD1 exerts its regulatory role in copper homeostasis through the regulation of ATP7B stability.
17309234 COMMD1 specifically binds copper as Cu(II) in 1:1 stoichiometry & does not bind other divalent metals. Fluorescence studies of single point mutants of the full-length protein revealed the involvement of M110 in addition to H134 in direct Cu(II) binding.
17183367 COMMD1 accelerates the ubiquitination and degradation of NF-kappaB subunits through its interaction with a multimeric ubiquitin ligase containing Elongins B and C, Cul2 and SOCS1 (ECS(SOCS1)).
17097678 The solution structure of the N-terminal domain of COMMD1 (N-COMMD1, residues 1-108), is presented.
16649058 Observational study of gene-disease association. (HuGE Navigator)
16573520 These data support the significance of COMMD protein-protein interactions and provide new mechanistic insight into the function of this protein family in NF-kappaB signalling.
16283886 COMMD1 is not a significant contributor to Wilson-like copper storage disorders in humans.
15799966 MURR1/COMMD1 functions in the nucleus by affecting the association of NF-kappaB with chromatin
15205742 3 intronic base pair changes, 1 new sequence variation & 2 known polymorphisms were detected, including the GAT/GAC heterozygous state at Asn 164 in 24% of the patients. GAT/GAC heterozygosity at Asn 164 is associated with earlier onset of Wilson disease.
14685266 XIAP functions through MUUR1 to regulate copper homeostasis.
14685242 Murr1, a gene product known previously for its involvement in copper regulation, inhibits HIV-1 growth in unstimulated CD4+ T cells
14645214 Murr1 is a novel regulator of delta ENaC
14568250 MURR1 was detected in different tissues and cell lines; in cell lines it was found both in cytosol and membrane preparations; in some cells MURR1 was associated with a vesicular compartment diffusely localized throughout the cell
12968035 findings reveal involvement of Murr1 in the defined pathway of hepatic biliary copper excretion, suggest a mechanism for Murr1 function in this process, and provide evidence in support of the proposed role of the MURR1 gene in hepatic copper toxicosis
12547404 No mutations in the MURR1 gene, including the intron-exon boundaries, were identified in a total of 23 patients with non-Wilsonian hepatic copper toxicosis

AA Sequence

MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN      1 - 70
QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT     71 - 140
PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN                        141 - 190
//

Text Mined References (66)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25520503 2015 COMMD1/Murr1 reinforces HIV-1 latent infection through I?B-? stabilization.
25416956 2014 A proteome-scale map of the human interactome network.
25355947 2015 COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.
25074812 2014 p300-mediated acetylation of COMMD1 regulates its stability, and the ubiquitylation and nucleolar translocation of the RelA NF-?B subunit.
24691167 2014 The Copper Metabolism MURR1 domain protein 1 (COMMD1) modulates the aggregation of misfolded protein species in a client-specific manner.
24625556 2014 Deregulation of COMMD1 is associated with poor prognosis in diffuse large B-cell lymphoma.
23892095 2013 COMMD1 modulates noxious inflammation in cystic fibrosis.
23677795 2013 COMMD1 and ion transport proteins: what is the COMMection? Focus on "COMMD1 interacts with the COOH terminus of NKCC1 in Calu-3 airway epithelial cells to modulate NKCC1 ubiquitination".
23637203 2013 Functional interaction of COMMD3 and COMMD9 with the epithelial sodium channel.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
23515529 2013 COMMD1 interacts with the COOH terminus of NKCC1 in Calu-3 airway epithelial cells to modulate NKCC1 ubiquitination.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23364987 2013 Expression and localization of COMMD1 proteins in human placentas from women with preeclampsia.
22677543 2012 Molecular analysis of Wilson patients: direct sequencing and MLPA analysis in the ATP7B gene and Atox1 and COMMD1 gene analysis.
22130675 2012 Clusterin and COMMD1 independently regulate degradation of the mammalian copper ATPases ATP7A and ATP7B.
21778237 2011 COMMD1 (copper metabolism MURR1 domain-containing protein 1) regulates Cullin RING ligases by preventing CAND1 (Cullin-associated Nedd8-dissociated protein 1) binding.
21741370 2011 COMMD1 regulates the delta epithelial sodium channel (?ENaC) through trafficking and ubiquitination.
21667063 2012 The copper-transporting capacity of ATP7A mutants associated with Menkes disease is ameliorated by COMMD1 as a result of improved protein expression.
21483833 2011 COMMD1-mediated ubiquitination regulates CFTR trafficking.
21275100 2011 The puzzle posed by COMMD1, a newly discovered protein binding Cu(II).
21269460 2011 Initial characterization of the human central proteome.
20595380 2010 Cu,Zn superoxide dismutase maturation and activity are regulated by COMMD1.
20550661 2010 A novel COMMD1 mutation Thr174Met associated with elevated urinary copper and signs of enhanced apoptotic cell death in a Wilson Disease patient.
20458141 2010 COMMD1 disrupts HIF-1alpha/beta dimerization and inhibits human tumor cell invasion.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237237 2010 COMMD1 downregulates the epithelial sodium channel through Nedd4-2.
20068069 2010 Clusterin facilitates COMMD1 and I-kappaB degradation to enhance NF-kappaB activity in prostate cancer cells.
20048074 2010 Nucleolar targeting of RelA(p65) is regulated by COMMD1-dependent ubiquitination.
19802386 2009 COMMD1 Promotes pVHL and O2-Independent Proteolysis of HIF-1alpha via HSP90/70.
19433587 2009 HSCARG regulates NF-kappaB activation by promoting the ubiquitination of RelA or COMMD1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18974300 2008 Copper-induced translocation of the Wilson disease protein ATP7B independent of Murr1/COMMD1 and Rab7.
18940794 2009 COMMD1 forms oligomeric complexes targeted to the endocytic membranes via specific interactions with phosphatidylinositol 4,5-bisphosphate.
18795889 2009 COMMD1 expression is controlled by critical residues that determine XIAP binding.
18305112 2008 Tumor suppressor ARF promotes non-classic proteasome-independent polyubiquitination of COMMD1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17919502 2007 Distinct Wilson's disease mutations in ATP7B are associated with enhanced binding to COMMD1 and reduced stability of ATP7B.
17309234 2007 Characterization and copper binding properties of human COMMD1 (MURR1).
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17183367 2007 COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase.
17097678 2007 Solution structure of the COMMD1 N-terminal domain.
16649058 2006 Mutation analysis of 218 Chinese patients with Wilson disease revealed no correlation between the canine copper toxicosis gene MURR1 and Wilson disease.
16573520 2006 Characterization of COMMD protein-protein interactions in NF-kappaB signalling.
16305817 2006 Comparative analyses of genomic imprinting and CpG island-methylation in mouse Murr1 and human MURR1 loci revealed a putative imprinting control region in mice.
16283886 2005 COMMD1 (MURR1) as a candidate in patients with copper storage disease of undefined etiology.
16267171 2005 The many faces of the copper metabolism protein MURR1/COMMD1.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15799966 2005 COMMD proteins, a novel family of structural and functional homologs of MURR1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15205742 2004 Analysis of the human homologue of the canine copper toxicosis gene MURR1 in Wilson disease patients.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685266 2004 A novel role for XIAP in copper homeostasis through regulation of MURR1.
14685242 2003 The gene product Murr1 restricts HIV-1 replication in resting CD4+ lymphocytes.
14645214 2004 Identification of Murr1 as a regulator of the human delta epithelial sodium channel.
14568250 2003 The ubiquitously expressed MURR1 protein is absent in canine copper toxicosis.
12968035 2003 The copper toxicosis gene product Murr1 directly interacts with the Wilson disease protein.
12547404 2003 The canine copper toxicosis gene MURR1 does not cause non-Wilsonian hepatic copper toxicosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11809725 2002 Identification of a new copper metabolism gene by positional cloning in a purebred dog population.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9001233 1997 Mouse U2af1-rs1 is a neomorphic imprinted gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.