Property Summary

NCBI Gene PubMed Count 21
PubMed Score 1.02
PubTator Score 24.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Malpuech facial clefting syndrome 3 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 3.3e-11
Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0
Disease Target Count Z-score Confidence
3MC syndrome 6 6.164 3.1

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.200 3.3e-11

Gene RIF (7)

AA Sequence

MNGFASLLRRNQFILLVLFLLQIQSLGLDIDSRPTAEVCATHTISPGPKGDDGEKGDPGEEGKHGKVGRM      1 - 70
GPKGIKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCDCGRYRKFVGQLDISIARLKT     71 - 140
SMKFVKNVIAGIRETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEAANTLIADYVAKSGFFRVFIG    141 - 210
VNDLEREGQYMFTDNTPLQNYSNWNEGEPSDPYGHEDCVEMLSSGRWNDTECHLTMYFVCEFIKKKK       211 - 277
//

Text Mined References (23)

PMID Year Title