Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.32
PubTator Score 4.16

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MHPEPLLNSTQSAPHHFPDSFQATPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYAPENYNSPASL      1 - 70
DTRTCGYPPEDHSYQHLSSHAQYSCFSSATTSICYCASCEAEDLDALQAAEYFYPSTDCVDFAPSAAATS     71 - 140
DFYKRETNCDICYS                                                            141 - 154
//

Text Mined References (15)

PMID Year Title