Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.32
PubTator Score 4.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A8K830 E9PMJ8 Q2TBJ3 V5LD62 V5LDI3 V5LDV1 V5LE09 V5LEU3
Symbols CASC13
C11orf93
LOH11CR1G

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MHPEPLLNSTQSAPHHFPDSFQATPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYAPENYNSPASL      1 - 70
DTRTCGYPPEDHSYQHLSSHAQYSCFSSATTSICYCASCEAEDLDALQAAEYFYPSTDCVDFAPSAAATS     71 - 140
DFYKRETNCDICYS                                                            141 - 154
//

Text Mined References (15)

PMID Year Title